brary i £ Carnell Law School ornell Universit: ‘an THE PRACTICE IN Actions and Spectal Proceodines IN THE COURTS OF RECORD OF THE STATE OF NEW YORK, UNDER THE CODE OF CIVIL PROCEDURE. BY WILLIAM RUMSEY, ———_ — JUSTICE OF THE SUPREME COURT. SECOND EDITION. VOLUMHA ITI. 1897. BANKS & BROTHERS: New Yorr. ALBANY, 14505 Copyricut, 1890. BANKS & BROTHERS. _ Copyrieat, 1897. BANKS & BROTHERS. TABLE OF CONTENTS. CHAPTER XLIX. EJECTMENT. PAGE ARTICLE I. Nature of the action of ejectment....,............05 sidieues. “El Bec. 1. Origin, and HIStory sacs cise cites cecereaiscaani esceswse sae ae cies 1 2. Hor what the: Acton Nes. sccccscancdee sume nsawedan eaeers 3 3. What title necessary to maintain action............ceeceees 5 4. What may be recovered in the action..............20eceeee % ARTICLE II, Parties to the action.......0 6... ccc cua cee eeeeeee coe 8 Sec: 1. Who may be plaintiffs. jss-sie wevce ax ea aus Sneerain eins eeeeees 8 2. Who may be joined as defendants..............ce cree eeeee 9 3; ‘Changeof partless ocsccenes ss ceswsonvneeney eacivawtadaetas 10 ARTICLE III. Pleadings and proceedings .............c ccc eee e eee il Sec. 1. The plaintiff’s pleadings .....................5 6 isscaphapisitets 11 2. The defendant’s pleadings. 2.2. ..... cece eee eee ences 13 8. Proceedings in the action.......... 0. cece ee eee neon eee 14 Subd. 1. Proof of authority to bring action.............. 14 2. Provisional remedies...........00.ceeeees ssanee 16 3, DULVEY. ssucrwanerminne woul aan aw seatigaaniie 16 4, Other proceedings before judgment........... « AT 5. Form of verdict..cciswiesaes os sesewreesaer sen 17 6: JUASMENt cepciccaycenieheavs Deeesess anaes 18 he. INOW tral ae stseiniomn aise Ne Ra Nai Saison Geieeees 18 8. Opening. default ..... ... ec cece cece eee cece 19 A. HMLCCh Of Che JUMP TERE os cise sdveyscsssntvwcacanive ce a dvanaratn are a auaenveielare 20 ARTICLE IV. Proceedings where action is brought for rent in arrear.. 22 Sec. 1. When action may be maintained................0ceeeeeees 22 2. Payment or redemption by tenant...........eeeeeeees senna 24 CHAPTER LI. PARTITION. ARrTIcLE IJ. In what cases partition may be had.............00008 wears 26 SoC: Da ANGtURE: Of, HS OTTO ase win ore teens vats aveneearateraigigrere Grereisiniese sleielas 26 2. By joint tenants or tenants or tenants in common.. ........ 27 Subd. 1. When by parol or agreement.......... toate 27 2. When by actionisnns sececscwaetiws sean veces es 29 8. By remainderman 3 oc. .ccewsewwerscn Soaetae Giodeawawes . 32 Ay coy SAUL, MITT Go co asad, de “giertoeedconevinn i vactucaduandites 6 Mesa Wis aotaee 6.0% 33 5. By heir, when devise claimed to be void..........seeeeeeees 35 6; PATHES 46: GHG: BOHO Mc ccsracyyccess wainicain dinosieiw ie as col eres taaverdearajarere 36 1vV TABLE OF CONTENTS. PAGE %. Notice of pendency.........seeeeeeeeeeeeee Ais Storeuegs wiave Oe 39 ARTICLE II. Proceedings in the action........ edule deeweeeeterts 39 Sec.1. The complaint........ 00... cece cece eee een een e ee eereees 39 2. The answer..... 2... cece cee ce ee eee nee e eee eee tenes 40 3. What questions may be raised....-..+-2e+ ee errr reer atte te 41 4. How issues tried... 0... ccc eee eee een eee neee weeeee 48 5. Proceedings upon default. ........... +e cece eee e eee ences 43 Subd. 1. Reference to ascertain title....... 2... wee... . 48 2. How liens ascertained..... ......... csc eee eee 44 3. Proceedings where partition cannot be made.... 46 ARTICLE III. Interlocutory judgment .... 22... fee eee eee eee AT bec, d. What tocontaims ci.n tasiuiciwaudes pegeney Shoe ee RS Bee Sok 47 2. How modified or changed........-...... .....05 Seah Zecca “DO ARTICLE ITV. Commissioners to make partition..............c0eec0e 51 Sec. 1. How qualified and removed.............. HioWinwie eta ed a 51 2. How to proceed sce sz sng ewusing iid siaase cn gle didey uaa cwcieles 51 8. Proceedings where there is a particular estate............... 53 4, Report of commissioners........ ......e.006 0s seoresee eis 53 ARTICLE V. Proceedings to sell real property.......... eee esiouexees 55 Sec. 1. When a sale will be ordered .............0 0.00008 eae saat 55 2. Judicial sale, how made......... cece ee eee amiale: Fac eeh eas 57 Subd. a. Noticesof sale: ciess cea sys oy een ssaeassecawests 57 2. Duties of referee or officer making sale......... 59 Bs Salelics wingers oc i 8abs Vane she hace Saeed 60 4: Reportiol sale scn0 Soni. <2 ies Bicone aeadesedes 63 5. When sale set aside, and resale................ 64 6. Rights and duties of purchaser................ 67 83. How purchase money secured.... 21... cece en cae cece eee 71 A: COStS Ma PATtlHlO Us 4404 dv winter enwenrsinw Seana oais aie ded deSS ENS 71 5, Distribution of the proceeds... ......-......00. sieeteadtads 4 Subd 1 in weneralesycccntwateneyuaay das we xadancske 73 2. Where party is an infant, or unknown. ....... 75 8. Where dower right exists.................... 76 4. Where liens exist..... 2... (cee ce cece cece eee 78 5. How invested for tenant for life, etc........... 80 ARTICLE VI. Final judgment......... pe ece cece c ee eee eeeeeeeee 80 Seeid.. What tocontain jn. che coe vinaveseee wey dcacw ened eae 80 2. Who affected by final judgment.... 66.6... eee eee eee eee 82 8. Security to TERING s «4 ae qncved seein Pohang awe dae 4 eaves 84 4, Where entered and recorded.....-.....20 cece eee eee ieeeins 84 5. Judgment, how enforced .... © 1... sce cece ee eee eee neers 85. 6. Appeal from final or interlocutory judgment.... .......... 87 CHAPTER LI. ADMEASUREMENT OF DOWER, Articte I. How action brought............ +. er ere 88 Sec. 1. History and nature of the proceeding......... ........0.., 88 TABLE OF CONTENTS. v PAGE 2. Who may bring the action.... ......ccceeceeeeeeeeeeceees 89 3. Who are proper parties defendant...........seeeeeeeeeesers 90 4. What may be recovered........ ccc eee cece eee ee et eneeees 90 ARTICLE II. Proceedings in the action.............cceceeee eee eeeeee 93 Sec.1. Pleadings........ ..... ssee parables adams ates Sotelataie eo wiate aca 93 2. Proceedings before judgment... ......... ec ee cece ene cena 94 8. Interlocutory judgment........ cc ee eee cece eens 96 Subd. 1. For admeasurement of dower...............+-- 96 2. For sale of premises. ..........ce eee cree eeeee 97 4. Proceedings before commissioners...........eeeeeeeeeeeeee 98 5. Report of commissioners or referee... ..... eee e eee cece cere 101 6. Fees and expenses. .......... ccc ee eee cence sence ee enees 102 % Hinal JUdSment: ves ce ates tescae snes Me WaeeweRewod 102 Subd. 1. After admeasurement............. cee cece ener: 102 Ry ATO a: BAIS ua end Ges ees no Hae REEMA aE 103 B.. Stay OP APP si. asscid se nivetraisiereterdwrceea da lears 104 8. Right of widow after judgment......... Sovpcrinaisss arene See cet 104 CHAPTER LIL FORECLOSURE OF MORTGAGES AND LIENS. ARTICLE I. Foreclosure of mortgage on real estate...... 6 .seeeeeeee 106 Sec. 1. History and nature of the action for foreclosure...........- 106 2., Remedies of the mortgagee... ......... cece cece cece eect eee 108 8. Purpose of the action............... zidbaes ayaa ae aOR ERIS 109 AgTicteE II. Bringing the action............. cece eee cree cece eee 110 Sec. 1. In what court to be brought..........ceeeeee- seen seoese 110 2. Place of trial....... siahaig a¥eln cis cenorata ver ciorelmacatemle mae mecie me 110 3. Who may be parties.......cccccceccrecscsccceceesenecens 111 4. How to bring the action.......... ccc ce cence cece eee e eens 111 5. Pleadings ......... avenslguiia cuba seeder eeukGaneceeounanie ds 112 ARTICLE IIT. Proceedings in the action..........cccsceecncveeeeees 118 Seen. Default icscansd's t.5 cay ecdetasinns, Sriuceaxanos tie ter eee 113 Di TAAL jas Srsucsedetee’, laid B:5:,a1aiheole ae olaial apne) Seasaraibiaie wiofe ane Sayouaes ndeie ie ddd 8. Provisional remedieS.......... 0... eee cece cece eneeeeees 115 4, JUASMECHE so icidcsccey aie s-aisa.s siavedardieslag Meiemelwuleis Sea Awe oes 115 5. Tenderof amount: due: s..is.. avesdswaww kaw dais sede ss es ena'es 119 ARTICLE TV. Sal@:qewse sss vied gd aamanns se eeeee area eaae awa yee 120 Sec. 1. How and by whom made......... cc .c cece cece sence cence 120 Py CONVEYANCE: 6 225 hay 5.3. cuce. Bil metecwaedsaeage Need sac ee 124 3. Referee’s report of sale, and confirmation..............+++- 125 ARTICLE V. Proceedings after sale...........ceccecee cence ence eeees 127 Bee, 1, Deficieneye v.26. ccgidicdinges. akadecs bees. govaeetera os 127 2. Distribution of the surplus .... 0 6... .... cee ce eeee eee en eee 128 Subd. 1. How disposed of by the referee.......... ..... 128 2. Filing claim to surplus.............0.. e228 0+ 129 8. Motion for reference ... .........seeeeee sees 129 4. Proceedings before the referee................. 131 vi TABLE OF CONTENTS. PAGE ARTICLE VI. Strict foreclosure of mortgage...........++% AG PASS bac 133 Sec. 1. History and use of the procecding..........eeeeeeeeee nsec 134 2. Proceedings in the action... 2.10... . sce eeeeee scene ee eeere 135 Arricie VII. Foreclosure of liens on chattels............eeeeeeeees 137 Sec. 1. When and where maintained ....... (6. ee eee ee cece eens 187 2. Proceedings in the action... .........5..0- seccsconccesecs 188 8. Seizure of the chattel..... 2... cece cece ec cee ence rceccees 139 4, Proceedings in courts not of record..... ..+-.eeeee. ores 140 CHAPTER LULL OTHER ACTIONS RELATING TO REAL PROPERTY. ArticLE I, Action to determine conflicting claims to real property.... 142 Sec. 1. History and nature of the proceeding.............eeeeeeeee 142 2. Who may be plaintiffs... 0.0.0.0... ccc ween eee eee e se ce 148 3. Against whom the action may be brought.............-...- 144 A... PICKINGS op comeanatosnaaiyevatiemetraneceilecwkmemutn sos 145 5. Proceedings before judgment. ............. 0 see e cece eee eee 147 GSUASMCNU. cacus weeny ceocatiaasincricnme medion Geieeie vie irs 148 hs NOW tial s.< vss scea eg a's wing ait sBewieaeel gun ase elk eee 084 149 8; Effect:of judgment iisi4 scaeis a: ocinncasannenacnee ane eaces eons 149 9. Action against claimant of dower............ Pewee anaese eu 149 ArticLE II. Action for waste.............. ease Wuonilie SEW Gls Gwe. bee tele 150 Sec, 1. What: Is Waste. oa:.cucuisiusaweawndcewreperaeeeesesn. vee 150 2. Remedies for wastes...ssvestvadcwne tes some cies acces 45495 151 3; Whomay be ‘plaintiffs jcc sssves sescvee rave ses exes ee caseas 152 4. Against whom the action lies......... 6... eeeeeeee eee e reese 153 5. Proceedings in the action . 2.2... ccecec ceeds eseseccssaaesss 154 G. JUAPMEDE 2 sca cane cedavenas oy ea SxS pee SHAS eae os oe 5 OSS 155 7%. Action by joint tenant or tenant in common................ 156 ArgticLeE III. Action for a nuisance............. fee ee eee eee cee 157 Sec. 1. The remedy for a nuisance... 2. 11... eee eee eee eee es 157 2. Against whom the action may be brought We oaeaegn aownblheoata 159 8. Proceedings in the action............cccereen ever ececscees 160 4, - Judgments socsumuis cmsaciay ach cde cnet Gates tae anya 160 ARTICLE IV. Action against persons holding over...............-.. ARTICLE V. Action by joint tenant to 1ecover his share of rents and PLONE Sospacweed Gaon Me aa one ae a Abe aes 161 Articte VI. Action for timber cut by trespasser...........--..25-- 162 ARTICLE VII. Action against forcible ejectors......... eee eee eee eee 163 CHAPTER LIV. ACTION TO RECOVER A CHATTEL. ARTICLE I. When it will lie... 01. Lecce ce eee eee eens 164 Sec. 1. In what cases it may be brought ..............6. SeeRE ee 164 TABLE OF CONTENTS. vii PAGE 2. For what it may be brought..............eeeeeeeee sive wey LUO 3. Waiver of right to bring replevin............ suave dic daaee alae 172 ARTICLE IT. Proceedings in the action.......... 0c. cece cere ee eee eees 173 Sec. 1. When anf how commenced,..... ....cceeeeereeceeceeees 174 2. Pleadings and proceedingS............cceeeeeee eee eeeecees 175 Bi. Verditts acuse saiswhaiasaiadck tude taee tows scabs eos esaens eon 177 4: SUA EMIED «icoanctcnwwin iin eae soe cleb'es ata aan eeaueen 178 ARTICLE III. Taking the property.......... cc. cece ees eee e cee te eee 180 Sec. 1. When the property-may be taken...........ecc ees eeeeees 180 2. Affidavit and requisition. ............ cece cere cece erences 181 8. Undertaking by plaintiff... ........... .c csc ee eee eeeenee 184 4. Remedies for defective papers... 1.2.20... ese eeee cence eeeee 185 5. How chattel to be replevied)...... ..eeec cece eee eee e eee e es 186 6. Custody of the property by the sheriff................ 00000 186 %. Exception to plaintiff’s sureties..... 0... cece ee cee eens 189 8. Redelivery of the property to the defendant................ 190 9. Justification of sureties............ Bardens eran Aye tie elceveiavaiese 192 10. Action on the undertaking......... 0... cee seee eee nee ee cee 193 11. Claim of title by a third person. ........... cece eee eee eee. 194 12. Second and subsequent replevin.. .........cceee cece eeees 196 CHAPTER LV. MATRIMONIAL ACTIONS. ARTICLE I. Jurisdiction of the courts......... ccc scence ee ere erence 198 ARTICLE IJ. Action to annul a marriage........... cee cece eee eee 199 Sec. 1. Action by a woman married under the age of sixteen....... 199 2. Action by either party to annul a marriage..............06. 200 Subd. 1. Because contracted before the age of legal CODSCNG a5 oases aera eaceeage nn euunivendeu te ees S gex es 201 2. Because former husband or wife of one of the parties was Diving. 5.6e ss ees eee ag sic e'slsle's os 201 3. That one party was an idiot or lunatic.......... 202 4, Where consent was obtained by force or fraud.. 204 5. For IMpoOteneye cscs. cee eesesitaaw cous seven cs 205 8. Proceedings in the action.......... cc. c ce cece eee ee ee eens 207 ArticLe III. Action for a divorce...... ce hw aed Ma Ved baits Saad sac¥ 211 Sec. 1. When it may be brought ........... cece cc eeseeneee sence 211 2. Proceedings in the action...... 0... cece cece ee eee eee 216 8. Regulations with regard to the judgment.....--++.... 260 223 ARTICLE IV. Action for a separation........... cece eee ee eee e eens 229 Sec.1. For what causes an action for a separation may be main- EATINOG Kaufman v. Thrasher......... Kearney’s Case........... 471, Keeler v. Brooklyn Ele. R. R. Keihen v. Shipherd........... Keller v. Payne.......... 2... Kelly v. Kelly....... ........ Kelly v. Israel............. 60, Kelly v. Pfaudler Process Co., Kelty Vi. Yerby sac: vasiacisgatenns Kendall v. Treadwell..... 184 Kennagh v, McGolgan........ Kennedy v. Kennedy ..... 231, Kennedy v. Norcott 462, Kennedy v. Thorp............ Kennedy v. Weed........ 423, Kennedy Co. v. McCormack... Kerrison v. Kerrisun...... 202 Kerr ve Kerr’ oe. hécec.cu aun ss Kershaw v. Thompson........ Ketchum v. City of Buffalo... . Kidd v. Dennison............. Kimball v. Mapes............. Kincaid v. Dwinelle...... 2... Kincaird v. Scott King vy Orser' s,s os cee ee ages King v. Platt.......... 60, 121, Ring® ¥:, Puskas xc espece pees a King v. West...... .......05. Kingman v. Frank............ Kingsland v. Chetwood... 181, Kingsley v. First Nat. Bunk of 105 2387 70 452 472 259 448 339 232 121 276 279 436 136 286 232 471 484 461 254 227 224 1384 358 151 359 30 262 154 195 123 447 182 821 132 138 TABLE OF CASES. Kirby v. Kirby...... hs asters 218 Klein v. Wolfsobn............ 205 Knapp v. Burton ........ .... 32 Knapp v. Smith .............. 169 Knowles v. De Lazare......... 453 Knox v. McDonald. ......... 16 Koch v. Purcell .............. 68 Kock v. Kock............ ..- 239 Kohler v. Kohler .......... .. 34 Kortright v. Cady ............ 130 Kress v. Morehead........ 428, 486 Kyle v. Kyle ........s.eeeeeee 91 L. L. 8. & M. R. R. Co. v. Roach. 168 Lahey v. Kingon ............. 365 Lambert v. Converse.......... 365 Lane v. Salter .... ........0.. 368 Lang v. Ropke............ 20, 21 Lang v. Wilbraham........... 18 -Langendyck v. Burhans..... 6 21 ‘Lanning v. Carpenter ......... 153 Lansing v. Easton ... 387, 339, 340 460 Lansing, Matter of............ 486 Lansing v. Smith............. 158 Lansing v. Geolet......... 135, 134 Larkin v. Mann ........... 44, 538 Larkins v. Maxon............. 298 Larned v. Hudson ............ q Lathrop v. Clapp .......- 455, 458 Lawrence v. Brown........... 105 Lawrence v. Townsend........ 287 Lederer v. Ehrenfield ......... 405 Lee v. Delehanty ............. 468 Lee v. Heirberger ........ 428, 430 Lee v. Superv’s of Jeferson... 360 Levfevre v. Laraway ...... 62, 65 Leggett v. Boyd ............. 365 Leggett v. Sloan.........-..4. 478 Lehigh Coal Co v. Central R. R; Co. Of Ni dssomeawed cage 270 Lent v. McQueen ............. 840 Leonard v. Clinton............ 3829 Leonard v. Spencer........... 251 Lepprell v. Kleinschmidt.... 4, 10 Le Roy v. Halsey.... .... 454, 458 Leseur v. Leseur...... ....... 216 Leslie v. Leslie....... 289, 242, 248 Leslie v. Lorillard............ 252 Levey ve Bullig cccnsage agencies xxX1 Levy v. Kirby..........0.e00- 411 Lewellyn v. Lewellyn......... 236 Lewis v. Lewis........... 239, 243 Lewis v. Moloney............. 285 Lewis v. Oliver.......+....00 283 Lewis v. Penfield............. 449 Lewishon v. Drew...........- 826 Lewisohn y. Apple............ 178 Lichtenberg v. Herdtfelder .... 326 Lilliendahl v. Fellerman....... 411 Lindsay v. Sherman.......... 422 Lippencott v. Westray......... 444 Littell v. Sayre ........... 2... 306 Livingston v. Clarkson, 49, 54, 87 Livingston v. Haywood ...... 154 Livingston v. Mildrum........ 119 Livingston v. Peru Iron Co ... 332 Livingston v. Swift........... 447 Livingston v. Tanner ...... 12, 161 Loaners’ Bank v. Jacobi....... 193 Lobdell v. Stowell............ 169 Locke v. Covert ...........4. 270 Lockwood v. Faweett......... 806 Lockwood v. Worstell......... 452 Loeb y. Willis... ......e.eeeee 127 Loomis v. People............. 457 Loos v. Wilkinson.... 828, 880, 345 Londriggan v. N. Y. &N. H. R. Rs COsseceasis seeecce as 255 Long v. Stafford.......... 366, 372 Lovett v. German Ref. Ch.... 118 Lowrey v. Mansfield.......... 197 Luckey v. Gannon............ 171 Lupton v. Lupton........ 299, 300 Lutes v. Briggs. ............. 360 Lynch v. Johnson............. 400 Lynch v. St. John ........... 171 Lynch v. Rome Gas L. Co..... 85 Liyle vi; Smiths: :.:s0:0% siete ee ee 340 Lynde v. Lynde.............. 243 M. M. & T. Bank v. Dakin... 321, 329 McAdam v. Walbrau..... 1838, 185 McAlear v. Delaney......... 46 McArthur v. Hoysradt, 321, 345, 466 McArthur v. Lansburgh....... 424 McBride v. Farmers’ Bank .... 258 McCabe v. McCabe... ....... 42 McCartan v. Van Syckel...... 459 McCartney v. Bostwick........ 324 xxii McCleary v. McCleary ........ 218 McCorkle v. Herrman.,....... 487 McCormack v. Kehoe ........ 465 McColter v. Jay..........000. 66 McCreery v. Gordon.......... 333 McCulloch v. Norwood........ 265 McDermott v. Hennesy.... ... 133 McDonough v. McDonough ... 240 McElwain v. Willis........ eee 833 McEwan y. Burgess..........- 435 McGlynn v. Post............4. 349 McGowan v. Morrow.......... 72 McGregor v. Brown.........-- 151 McIntyre v. Clark. ........... 103 McKechnie v. Sterling......... 70 McKee v. Judd.............4. 466 McKeen v. Fish .............. 89 McKeon v. Kearney........... 36 McKim v. McKim....... .... 224 McLaughlin v. Teasdale... ... 61 McMillan v. Vanderlip........ 465 McNeil v. McNeil..... ....... 212 McQuienv. McQuien. ........ 241 McMahon vy. Rauhr........... 349 McRoberts v. Pooley..... 128, 133 sMcVeany v. Mayor, etc... 881, 394 M’Intosh v. M’Intosh.......... 218 M’Kinstry v. Mervin.......... 136 Madge v. Madge............. 220 Magee v. Genesee Academy 279, 281 Mahler v. Schmidt.......... 332 Malaney v. Cronin..... ...... 36 Malory v. Gulick ............. 443 Mallory v. Norton............ 483 Maltonner v. Dimmick........ 146 Mann v. Currie........ 0.2... 275 Mann v. Pentz........... 262, 275 Manning v. Evans...... .. 408, 479 Manning v. Keenan.. 165, 184, 195, 196 Maples v. Mackey ............ 372 Marble v. Lewis.............. 96 Marsac, Re.........-.6. ween 34 Marshall v. Davies ........... 127 Marshall v. Marshall.... ..... 227 Martin v. Rector.... ......... 23 Martin v. Sheriden............ 403 Marx v. Spaulding....... 441, 456 Mason v. Denison............. 365 Mason v. Hackett......... 401, 425 Mason v. Mason........... 38, 232 TABLE OF CASES. Masten v. Amerman...... 482, 485 Masten v. Budington...... ... 298 Masters v. Eclectic L. Ins. Co.. 265 Mather v. Freelove..........- 167 Mathews v. Duryee........... 133 Matter of (See name of party). Mathews v. Mielson.......... 837 May V MEY acteurs wis ein scounee 64 Mayor v. Mayor.............. 42 Mayor, etc., v. Campbell...... 22 Mayor, etc., v. North Shore 8. TL, Ferry C0ise.u6 oes ieacewes 4 Mayor, etc. v. Smith.......... 12 Maxwell v. Maxwell.......... 240 Mead v. Jenkins.......... 83, 310 Mead v. Mitchell ......... 27, 88 Mead Vi Spink. oii: ead edede 128 Megarge v. Megarge.......... 229 Meiggs v. Willis.----......0.. 86 Mellen v. Mellen.....:... 202, 208 Mendel v. Mendel............. 247 Méo¥: MeO... cain x atwaeanuea 208 Merch. & Traders’ Bank v. He ally iése ie sides aengnre wiacaennendien ine 456 Merchants’ Exch. Nat. Bank v. Waitzfelder ................ 370 Merchants’ Ins. Co. v. Hinman, 302 Merrill vy. Allin. «ses ces euisce 414 Merrill v. Merrill.............. 220 Merriman v. Hill......... 465, 466 Merritt v. Merritt............. 241 Merritt v. Slocum............. ATA Mersesaue v. Ryers........... 309 Methodist Book Con. v. Hudson 471 Metzger v. A. & A. R. R. Co.. 359 Meyer v. Mohr....... ....... 328 Mickles v. Towusend.......... 107 Miles v. Miles :............. 0. 240 Miller v. Adams... 418, 423, 428, 463 Miller v. Collyer.............. 123 Miller v. Hall ............0... 381 Miller v. Hooper.............. 403 Miller v. Wright.............. 35 Milliken v. Thomson ..... 399, 443 Mills v. Dennis............... 186 Mills v. Martin ............... 168 Miner v. N.Y. C.& H.R. R. Co. 278 Mitchell’s Case ............06. 461 Mitchell v. Allen ...... ...... 376 Mitchell v. Barnes ............ 16 Mitchell v. Mitchell ...... 217, 222 TABLE OF CASES. Moller v. Moller............. 219 Molson’s Bank v. Boardman... 267 Monarque v. Monarque ....... 88 Monk v. Monk ............... 240 Moore v. Appleby ..... ...... 35 Moore v. Brink .......... 348, 351 Moore v. Moore .............- 220 Moore v. Shaw........... 117, 126 Moore v. Westervelt .......... 187 Moot.v% Moodtss: osssscisedinee 32 204 Morey v. Tracey ..... ... 369, 373 Morgan v. Morgan............ 212 Morgan v. N.Y. & Alb. R. R. Gh. ax veueaennea aunt bens 275 Morgan v. Plumb............. 137 Morgan v. Potter ............. 481 Morgan y.Von Kohnstamm.... 474 Morrell v. Morrell........ 210, 217 Morris v. Whelan......... 879, 382 Morris v. Morange...........- 117 Morris v. Mowatt............. 310 Morton v. Weil ..............- 332 Moser v. Polhamus ........... 448 Mott vi Mott: ssccoccvex3 5400-48 69 Moulton v. Moulton .......... 35 Moultrie v. Hunt............. 3138 Mowry v. Peet....... 294, 295, 296 Muldowney v. Morris & Essex Ra Re@0s Gena sag ie taGow 162 Muller v. Muller.............. 205 Muller v. Struppman.......... 56 Munsell v. Flood ............. 180 Murphy v. Loomis............. 6 Murray v. Harway...........- 68 Murray v..Hay Ty 394 in action for separation. ...ccesceccseccecccsceerses dy 395 in action for injury to property............ praaarevctierr “Ty 396 what are such actions..............- aesrateneer tere weweiow Ay 396 not granted in action for. money ‘lost at play.......... i, 397 not granted where property converted and tort waived.. i, 397 when not granted for breach of promise............+. i, 397 for misconduct or neglect in office.......... Setesevcinvsress Ae 397 against attorney for money collected...... diteigs oigucieresies Uh 397 in action for money received in fiduciary capacity.... 1, 398,400 in action for damage for fraud or deceit.............. i, 398 in action to recover chattel, fraudulently disposed of.. i, 399 in action fcr conversion of public property........... i, 401 in action on contract for fraud in incurring liability.. i, 402 only granted when authorized by statute. ...........+ veer by 393 when should not be granted.:. ....eese. se caeeeceeceeee AL, 394 where right depends partly upon extrinsic facts............ i, 404 substituted for writ of née evedt....... cc ccc cee aee tice, 404 against whom it will be granted........ ...seeeeeeee iy 405 for what purpose order will be granted...... a eiiee ese Sas i, 405 privilege from arrest.............. 0 cee eee i ee eres veaswae. 15 406 who may be arrested. ........ .c ee eee eee eee speeaaee J; 406 when woman can be arrested. ..........0 eee eee wees ly 406 incompetent person, when to be discharged...... seed Bs 407 when infant cannot be....... eee eee eee ee eee ee eee i, 407 one sued in representative capacity, when cannot be... i, 408 members of congress, When.........000 cee ee neces oe A, 408 persons in public ser VICE x.senaaweei dl aease case Sicubteda: 408 members of legislature sai abtualalasatnw reg ba BSP Bates See, CT, 409 officers of legislature.............-5 hoi ciao Fine 5 sa alk 409 elector, on election day.. .... UE vee cpm Skea, Uy 409 PND a ecceshacaustosdscvcue mtaeene Sie-aea vial Matin Miele 4 sdesielee esa oy 409 soldiers of United States..............6. stuienewietemree ly 410 HOLE ON TM IDIStETS 9 ya inicinstondonee tonne eawernwibarmwnkers i 410 7 WItHESSES aici ninstv seen ataw enews Ke dane ceeehees Biever AS 410 parties: tO ACTIONS, WHEN a... ccc ea cogieieceeiew sacar cite, Oy 411 police officers ............-... a sig fee aitaierbimtinis wh ecere ise Ay 411 officers of court...........0005 seialeesteud. cette teem Sa weass ly 411 Prisoner in) aITeShes c2dss seaeeernesaarsameasesowrany i, 411 one brought within jurisdiction by fraud............. 0 4, 412 privilege, how waived ..........ce cece eee eee cette eee i; 412 papers, necessary to obtain... 2... cee eee e cee eee ee teenie ee i, 403,413 only to be granted on affidavit..............-6- coves J, 418 INDEX. 503 ARREST AND BAIL—(Continued): VOL. PAGE when affidavit upon information and belief sufficient.. i, 414 how facts must be stated in affidavit for........... seedy 414 papers must be filed..................04- ares wee ancy (Ng 428 undertaking to be given in..............- Sires Reeders i, 416 when required . ...... . cece eee es aera tieigre oe ee alee i, 416 when may be dispensed with............... 0. ee eeeee i, 417 order for, by whom granted..... sijsiei-oxeeceipaarat stays ss seas M) 417 when granted only by court.......c.eseeeeeeeeeeeees 1, 417,418 what county judge may grant.......... cece ee eee eee i, 418 when may be granted.............. a PEGE Cie aeess i, 417 Gontents Of Orders c a5 sc diediarciwa aan Seed ee eee eee i, 419 may fix time within which defendant must be arrested... i, 419 may state grounds on which granted............. ques, 420 must be subscribed by attorney............. eee ee eee i, 420 how vacated or modified. ............ 00 ee eee si siviatets saisees Ay 420 when application must be made to............... 068 a hae 420 must be vacated, if no cause of action, in complaint... i, 421 when made on papers on which order was granted.... i, 422 when founded upon proof by affidavit................ i; 422 when notice required < s.ccissse sec eeas caveiesen eee i, 422 county judge may hear motion for, on notice......... 1, 424 rules of decision, on motion. ............ 202. c cece eee i, 402,423 when motion to, may be joined with motion to»reduce Dall cos mnnnwalelee GhQwa candeaeaee Loe. can Se eo hee I, 424 to whom application must be made............ 0.2... i, 422,424 when court may require stipulation not to sue......... 1, 424 DOW APKCST MIAME sissies voaisieteoe greta a ce gre gests weareoaierer, dane vig his lew! i, 427 must be made within county............ cece ee eens iy 427 where time fixed for, cannot be arrested afterwards... i, 428 what papers must be served upon arrest.............. 4, 428 bail, how Givens sevcuiesema saves yes ae e's sens ecleinrsewsis i, 429,430 sureties may be required to justify on.......... ae vais 1; 430 proceedings upon justification of sureties.......... ae. ily 4380 where justification may be made.... 11.2... ee see eee i, 431 qualification of sureties on..............066 iduaseces 1, dl deposit may be made instead of bail................. - i, 482 deposit to be paid into court by sheriff............... i, 482 money deposited, how disposed of ...........-....... i, 433 when defendant entitled to discharge for delay of plaintiff, i, 425 liability of sheriff after arrest of defendant... ........... > AG 434 rights and privileges of sheriff, when liable............... i, 436 when bail may surrender defendant................6 wees Ty 435 how surrender to be made by bail ................6 e Ay 436 how surrender to be made by defendant.............. i, 436 liability of bail, on failure to justify............. cess eee dl, 437 pail can only be proceeded against by action.............. ij 437 when such action may be brought against bail ......... 1, 437,438 what defenses may be interposed in action against bail..... i, 488 how discharged before expiration of time to answer ...... i, 439 exoncration of, after action commenced.................. i, 439 504 INDEX. ARREST AND BAIL—(Continued): ; VOL. PAGE may be permitted to defend original action............06+ See, algo, PROVISIONAL REMEDIES. ASSAULT AND BATTERY: allegations in action for........ is Wedeniga webossewew ewes ASSESSMENT: will not be restrained by injunction............. enna at ASSIGNEE: how appointment of, alleged in complaint........se.eeees when counterclaim allowed against........... aOovshivereiereiele when substituted as plaintiff in place of assignor.......... ASSOCIATION: action by ar against, see Jomnt Stock AssoclaTION. ATTACHMENT: when not restored by appearance..............0e0e% peas notice of pendency must be filed, after warrant of......... cancellation of notice of pendency............eseeeeees Bs when and by whom it may be granted.................. . WHO TAY SUCLOUE iss iresinaieasis einaceiesiarecodiaielgniey Uneieiaie aie iace when non-resident may obtain.... ....... teaneeamemee in what actions granted........... cece ee eee ee cece eee in what actions cannot be granted.............. te eeeeeeee cause of action must exist at time of application for....... distinction between, under code, and under revised statutes only granted in cases authorized by statute ..... .. Sessa granting of, discretionary with court........... ... abet may be granted in action for unliquidated damages........ against non-resident .... ....... 6 aiesvepiiels Siew Sage eS what constitutes non-residence............eeeeee wee eees : when granted against foreign administrator .............. not granted against foreign receiver. ........ 6. cee eee eens not granted against resident member of non-resident firm. . granted against foreign corporation..........0.eeeeseeeee granted against national bank............45 sees ences against absconding or concealing debtors...............4. against one removing, assigning or secreting property..... property removed must be that of defendant.............. threatening to make preferential assignment, whether BTOUNG Of. w.ctracnccanleca nts Weshmeaas, abun ee goewe ees agreement to give preference, not ground of.............. assignment, fraudulent in law, not sufficient ground for... not necessary that defendant should disp se of all of his property to entitle plaintiff to......... 2... cece eee eee against public officer........... c66 caeecceecee Geneeees service upon all partners necessary to retain jurisdiction. .. service by publication, what sufficient....... 0.6. ..0e-eeee what jurisdiction retained, without actual service........, i, 440 i, 318 i, 471 i, 318 i, 864. i, 669 i, 179 i, 188 i, 187 i, 505 i, 505 i, 505 1,506, 508 i, 508 i, 506 i, 506 i, 507 i, 507 i, 507 i, 509 i, 509 i, 509 i, 510 i, 510 i, 510 i, 510 i, 510 i, 512 i, 512 i, 512 i, 512 i, 518 i, 518 i, 518 i, 514 i, 514 i, BIS i, B15 i, 516 i, 516 INDEX. 505 ATTACHMENT—(Continued): VOL, PAGE substituted service, not sufficient..... siba‘etslnceieinte'eiere) scalar Oy 516 by whom warrant granted......... Siaistskentais setveeadsnces dy GLT papers on which granted... .... digaeis avs wi eas seaaea? a hy 517 application must be founded upon affidavit........... i, 518 what must be shown by affidavit ..............22 005 1,517, 519 by whom affidavit may be made...............ee0ee- i, 518 cause of action, how stated in affidavit for............ i; 518 when affidavit on information and belief sufficient..... i, 518 when allegations on information and belief do not give PUPVISAICHON 4 cis cicngauwenwses eee age cee vigre’s oeeis nate i, 6519 amount due must be stated in affidavit for..... pewiw eae dy 519 , how statement of amount due to be made..... eee veee 1,519, 520 must appear that debt is due ........ ce sees ee ee emeaas dy 521 how non-residence must be stated in............ sasieal ay 521 facts showing defendant has absconded, etc., must be SHALE scuscart at auiesatensicucsmaintnteaant aie daeie-s ee deadlines Reaa 1 521 intent must be shown.... 1. ... sce cee ee wees i, 510, 512, 521 need not be stated, no previous application made...... i, 522 how other papers referred to in affidavit.............. i, 522 deposition of party connot be compelled........ ..... i, 522 deposition of third party may be compelled .......... i, 523 prima facie proof of fact sufficient............ 2.0.2 ee i, 523 what must appear in, in action against public officer.. i, 523 affidavits must be filed ss ccs. iaeaceeaesina cas aeeeaes dy 523 security on obtaining warrant............ ese cece oe ood; 524 undertaking must be given.............ecseee ee eeeee i, 524 if undertaking defective, new one may be ordered . i, 524 when amount of undertaking will be increased ....,.. i, 524 liability of sureties ....... ccc cece cece ence eee eeee i, 524 sureties not exonerated by vacating for error..,....... 1, 558 warrant improperly granted, no defense to sureties ... i, 525 warrant must be subscribed by judge and attorney..... Geese oll 525 must recite grounds of attachment..................- i, 525 to what sheriff, warrant directed........... ..... eeacrals 525 form of warrant..........06 eeeeee Sidisieataiesiiucsaaiise i, 525 several may be issued... ..... ceescecee eee ce es eeerees i, 525 may be amended). s scsses ccneceneesseticesis vee sccees 1, 525 liability of sureties’. ©... 66.6. cece cece eee ees awe s 1; 524 sureties not exonerated by vacating attachment for ELTON 3 86-25 aneae Seeks OMe aek dee TNA aa Ss i, 558 warrant improperly granted, no defense to sureties.... i, 525 execution of warrant, must be by sheriff ........... wea: Ay 526 how to be executed)... smiwesiscceg Ga reeeee sees seeees 1,526, 527 levy upon, not made after final judgment ........... 1, 527 sheriff may require indemnity............0. cee eaee - i, 527 inventory to be returned... ...... ccc cece eee ee ee eens 2 A 527 return of the attachment................ -- sna eNOS aie Ay 527 what property may be attached.............66. seseeseeee |, 528 real property may be levied upon.......... siviassiearetyaiete. dy 528 506 INDEX. ATTACHMENT—(Continued): VOL. PAGE how levy made upon real property........... fie diereerarsiae dp 582 lis pendens to be filed........ Besa fasta ouisudins HERR Guaveauni woaaecotete i, 582 personal property, what may be levied upon........... jee “4; 528 mortgaged property, what may be levied upon........ ... i, 528 money collected by sheriff 0.1.0... cece eee eee cee i, 528 property Ofa HIM. cds, axedaw sins Maer emew cs eessecE: see i; 528 property of foreign corporation..... id Vicia’ oy aa ai beta Rate i, 528,529 property disposed of, with intent to defraud creditors..... i; 529 stock of defendant in corporation... ...........0cceeeeees i 529 stock of foreign corporation, when not leviable upon..... sy 529 may be levied upon chose in action....... .......2-2- 26. i, 529,580 choses in action transferred before levy, not levied upon APGaNsStaASSONOL + oes. 3:54 eSMesien wraewne ve sew ws nesses 1; 530 legal debt only can be levied upon.................44 gene. by 531 levy upon personal property capable of manual delivery, how..... Seta Gablan oe Uae A VaR OM OS neiaa2 ees baa ds 582 failure to deliver ety warrant, does not invalidate levy. . i, 533 levy on property not capable of manual delivery, ee MADE: shar teccewocene Adulhicce mean tea wtieadaeees seen dy 533 includes property pledged............ eee cee ee eee alincciorera-d i, 533 judgment how levied upon............ ee eee ee eee Sealetbiés i, 534 notice of property levied on, what sufficient.............. i, 538d duty of debtor after levy...............5. aleieratreuestence ii 535 warrant of, lien from time of levy.... 2... .... cee eee eee i, 5385 levy does not relate to time of original demand of property, i, 586 when certificate to be furnished by possessor of property. . * i, 536 order for examination, if certificate refused ....... ..... i, 537 when such order may be granted................e-e eee i, 538 what examination may be had under such order.......... i, 538 remedy of sheriff after examination.... ...-............ i, 539 master of vessel, when entitled to undertaking upon levy. i, 539 formof undertaking... i045 350,054 dawindios near ieewesebees a, 540 inventory to be made by sheriff...............- Hemme Ss it 540 to be filed within five days...............5 esate ts 1, 540 failure to make, does not invalidate levy........... ae lly 540 May DEUMENAE cose peeus Ves ate t ee sees couse aoe i; 541 return of, may be compelled .......... 00. cece eee ee i, 541 what suits may be brought by sheriff with regard . at- TACHED. PIOPETUY sn. cade wade sone Vern smernrarareneaa i, 541,542 when plaintiff in action may sue to collect attached prop- CMY iuwiasin ssmaasoereec hanes apes tag wale mene eae i; 541 when plaintiff may be joined with sheriff in action already BLOUBN as vioe Guedes wesy saoesgassta aes dee eay oe i, 542 court may direct as to prosecution of such action..... pease UW 542 what application may be made as to, by plaintiff in second WALTHNE y Rac ssa See Ese teen Ginn Ge GAGE eee? 1 564 when plaintiff in second warrant, substituted in action.... 1, 564 when plaintiff in second warrant, allowed to bring action... 1, 56-4 rights of plaintiff in third and subsequent warrants. ...... i. 565 how far sheriff may attack assignment as fraudulent ..... i, 542 INDEX. 507 ATTACHMENT—(Continued): VOL. PAGE how property kept by sheriff............cccseceseeseeeee 1, 548 when sheriff may be compelled to pay money into court... i, 543 lien of sheriff upon levy, nature of........-....- aed dteiavesen,- tly 544 duty of sheriff as to books taken............ lo SHahelatoke wear. Ay 544 money lost, who liable for............... 2... ais aes s dy 544 when court may release property attached........... .6.. i, 544 when court may direct things in action to be sold......... i, 567 notice of application for such order............ Steeeasea, J, 567 perishable property may be sold..... Sow RE RE MieieMiosibceseaye | ay 545 adverse claim to property, how tried...... ase feverca Ss sasceramccesia bag 546 proceedings on claim of vessel.............00- tale betarauspaien 1 ay 546 proceedings on claim of foreign vessel................... i, 548 who may move to vacate or modify warrant.............. i, 549 what lienor may move to vacate or modify...... .... i, 550 upon what grounds he may MOVe...........-.seeeeee i, 550 lienor need not become party to suit....... eet RASA i, 551 defendant may move to vacate, although undertaking has been given to release property........ 0. cee cece ee eee i 551 what is such application of property as bars right to move, 4, 551 motion to vacate for irregularity, when must be made..... i, 552 motion upon papers, to vacate, when made.............46% i, 552 what papers may be used by lienor... ..........- se eee eee i, 553 when motion made on papers, no opposing affidavits to be TEAL) acces cheese tas shen cdi sao ~ ire heel gh ahalcesei tan Wiese ep tests hag oy bee ie i, 553 what proof by moving party permits new affidavits to be Tedd keeway «pe sauecrae ee setenaaiueg- _eesielas i, 553 when motion may be founded on new proof by affidavit .. 1,552, 554 what constitutes new proof ...........5 ccc csee can ceceee i, 554 what plaintiff may establish by new affidavits............. i, 554 when more than one motion to vacate may be made....... i, 556 motion to vacate on papers, when granted............ 2+ i, 556 court will not pass on merits on motion to vacate ......... 4 557 motion on new affidavits, when will be granted..... ..... i, 557 technical defects in proceedings, may be amended on motion LO WaGale aiovaeteareim atedanoaa nines Saw cae leone ed migmiaye i, 557 effect of vacating for irregularity...............0. conse i; 557 effect of vacating where erroneously issued ..... cei euewe's i, 557 duty of sheriff, where vacated for irregularity............ i, 558 when sureties not discharged by vacating................. i, 558 application for discharge of property from, defendant only may make...... 0... pre cbaubdigabe Selina! mies ORGS CRU ae i, 558 part of property may be discharged... .... siieisintatpisiaianar qocers i, 558 what notice of application required...... ........-. wee i; 558 when court to direct notice to be given....... cece eee a; 559 undertaking required on such application ............0006 i, 559 to be presented at time of application ..............4. i, 559 form of, when application made by less than all defend- SULA we psae ayaa yeaa PG: Migcarayg rid Heed araneearmubvarneeeeaane is 560 must be filed with clerk.......-+-- Heiss favorccncapaseasetatiavsidl? 1, 560 justification OL SUPETIES ON wate, spares bee penlaons emteatanse i, 560 508 INDEX. ATTACHMENT—(Continued)- VOL. PAGE sheriff responsible for sufficiency of sureties on....... i, 560 sheriff, when must retain possession of property .......... i, 560 application for discharge of vessel from........... ..++0- i, 561 application by partners to discharge property from........ i, 561 what undertaking to be given on ......... eee eee eee i, 561 how amount of undertaking fixed .............66. tava tas 562 what notice of application to be given ..............000% » i, 562 duty of sheriff, where second warrant issued ..... Siar ete ve 562 how levy made under second warrant .............. weew Dj 562 when levy cannot be made under second warrant ......... i, 562 preference, where two or more warrants issued ........... i, 663 rights of plaintiff in second warrant against foreign vessel. i, 563 when may be attached under subsequent warrant..... i, 563 when cannot be attached after release........... wisest Ay 563 judgment upon, how stayed ........... eee ee eee visnaee A 566 execution upon, see EXECUTION. unsold property levied upon, how disposed of ............ i, 567 application for order of sale for....... meas deettiete hoe ie sis 567 what notice of application to be given................ i, 567 when person having property of foreign corporation may be required to Pay OM... ccc. ses ecseancen ereneinecwe aoe. oi 567 after warrant anuulled, to whom property delivered....... i; 568 ° sheriff must deliver books, etc., to defendant............ 3 i 568 when assignment of undertakings must be delivered to GEENA s ci tacts ocean ee Mae nvanind wmewmeenae i, 568 after vacating, defendant to be substituted as plaintiff in SUIT DY Sherifl gos scceniviowe ra meelgwan ns pee ewes ee baie 1, 569 lis pendens to be cancelled after vacating...............- eA 569 return to be filed after vacating ..... jowipanrse ees sales ots i, 569 warrant of may be amended ............ 2c cee eee eee eee i, 641 See, also, PROVISIONAL REMEDIES. additional allowance in action, where warrant of issued... ii, 514 sheriff’s fee for serving warrant of .... ............- wee. 11,558, 555 warrant of where execution has been issued, contents of... ii, 805 execution of, where warrant of has been levied........... ii, 834 levy where warrant of has been annulled............. .-. il; 835 may be issued pending supplementary proceedings...-. .. iti, 411 ATTORNEY: admission to practice, and removal of.......... wpanbeveciecstane,4 Uy 22 proceedings to punish ........... sean ew Oe eee ass seis: weer PUG 23 effect of suspension or removal...... eee ee dl; 24 how controlled by the court .......... ease Slaieernate binlaie eats i, 24 how punished for deceit or collusion ..........++++ soa an 1, 25 not to lend his name......... 2. cc cence ee eee eee teen eee i, 25 not to buy choses in action with intent to bring suit...... & Yl 26 such intent, however, must be proved... ......eeeeeeeeees i, 26 what not forbidden..... 0 «-..-... seen er ee er i, 26 shall not pay to procure claims for suit ........+..+6+ wee FU, 26, 381 for what purpose may receive thing in action ..........-. i, 27 shall not be bail or surety. ...-.... sees ee eee sea sah euanaranisiars i, 27, 231 INDEX. 509 ATTORNEY—(Continued): VOL. PAGE only those admitted can practice in New York and Kings COUMUMES a Sid eueie: sven hie bce lacee one arse sae Seale ase BOS wT oe i, 27 proceedings upon death, removal or disability of.......... i, 27, 221 service of notice on surviving partner sufficient .......... i, 27 when privileged from arrest .............4 spl dhcpelsha eam ese i, 28 authority to practice presumed ..............00008 eee 28 when authority must be proved ....... eee eeteees Ry 28 powers and limitations under retainer........seceeeeeeeee L 29 and client, when relation ends............ Ba inde eeeio'w elesve | ty 380 OW: SWDSEICULED areca ene A we taewcseeua es i, 30 lien of, upon papers for services..............06% ceceesee A, 80, 31 may agree with client for compensation...... .........4. i, 30 when court may set aside such agreement for compensation, i, 31 whether notice of lien required. ........... 0c. cease eee i, 382 right of parties to settle without regard to lien............ a 82 lien of, how may be enforced...........0..e cece eee eeeees i, 83 when compensation of, may be fixed by summary proceed- § TD BS gamaaanteasbie ad sda wale eictsueeeds, Welgiranee he ee sees Poe 83 for one suing as poor person, lien Of ...........cc cece eee i, 34 effect:of appearance: by-snosseegsevesis Se tear caea ve ae te 4 Ay 177 when authority to appear may be disputed............ ee 178 papers must be signed by «c.seci vss sisenveswsecewasceees a; 218 service upon, how made..............cceeeeeeee vss Sosa 221 when to cause papers to be filed . ...... ee cece eee eee eee i, 225 when verification may be made by ..-........ceceeee eee ee i, 264 will be charged with costs on motion to expunge scandalous Mattel dane dade seas dadesisentoe en made wes Bee i, 800 when need not produce papers of client upon subpena ii, 76 absence of, when ground of postponement ........... ii, 217 when liable for costs... .......2 0 ceceeesees ae atauts ches ay 448 See SECURITY FOR Costs. ATTORNEY: proof of authority to bring ejectment.......... eee as .. iii, 14 when may institute supplementary proceedings. .... wraitisizeeray AU, 406 ATTORNEY-GENERAL: © action by, against trustee of corporation ............. osteo dl, 256 action by to dissolve corporation............... dsteelaes slr dllys, 3263 when may bring action to annul corporation, ........... iii, 277 when must bring such action...........0...-sceceecerees iii, 277 when may bring action against usurper of office or franchise iii, 381 AWARD: cannot be made on Sunday... .....scscscvcceccecsceesses L, 4 | B. BAIL: sheriff cannot be. ......... ri scctzial sth wslablateetda enna etonioterd +s 17 attorney cannot be..... eeadated eae a SRY Hees oe sueeies eer. Ah 27 See, aiso, ARREST and Bam. 510 INDEX. BANK BILLS: VOL. PAGE not within statute of limitations..... Dielerele e-eieisiaieceicasegeele Ah 83 BANKING ASSOCIATION: actions by or against may be in name of president ........ i, 109 actions by or against stockholders of......... semen: wave: I, 110 in what name to sue or be sucd.........ecceeee tsesesveas HL, 314 receiver in, proceedings against. ..........eeeeees Biciare sears, A; 597 BANKRUPTCY: stay of proceedings after adjudication of .......seeeee.ee- Hd 179 stay after discharge in.............seeeee sieteccesesseres D L179 BILL OF EXCEPTIONS: what to contain...... .. gia aistate sidale dieia-3 0 Wald-aie'e sine oe Li, 388 See, also, CASE AND EXCEPTIONS. BILLS AND NOTES: allegations in action UPON.......... see eeeeeeeenee aie siete i, 314 counterclaim against transferee of overdue...... seieinee aes i, 366. BILL OF ITEMS: when party entitled: tO. sccsis ccc gieewiaiseieigio:siecie wieiaiaidiore is leiete'e's © i, 274 demand must be made for... .....escecescaeee oc aieevel ein bass i, 274 WA AMUSh: be Stated in vc ssors.c eve sere wives Sie-e wipe. oa 6's\e sisiele'® a's. i, 274 when further account will be ordered..........+ sis'eese lees i, 275 penalty for failure to Serve ........ ccc 00 cere eee onic eae Aj 275 BILL OF PARTICULARS: in what cases will be ordered to be delivered ........0.00- i, 276 discretionary With the court. ..........ecceeeeee at besesis i, 276 obtained Only by Orders « vcsdeccsssk cee ssseee ewe Caw vee i, 276 OMCE Ole. os po 2.4 aed a aedesins dns aAleeaaiarR eave veces 1,276, 280 granted in actions for tort............. RCA RERT EELS OS i; 277 application for, how made.........eeeeeeee SGiCRR Re Rae i, 278 affidavit for, what should state... ....... cc. ee cee ees ee eee i, 278 Ordet fOr, LOM Oly s «4 soiwalauanransarn neieueaie he Reeeaeee 1, 279 what should bé GOntaimied IM, civsecrsecaeeen eee Wee Ay 279 further bill, when granted...........ccee cee ee eee ee eee i, 280 effect Of: Gacngs: Raa ox santas Biel alelaiwieie ewe edt S BEER! fare i, 280 penalty for disobedience........ 0... ee cere eee eens “uaiesses i, 281 penalty for disobedience, may be inserted in order........ 1; 281 examination of party to enable adverse party to furnish... ii, 6 BOARD OF COMMISSIONERS OF PILOTS: when must sue for penalties and forfeitures .......... wea 5 119 BOARD OF SUPERVISORS: when may sue or be sued.........eeeeeeeecerceeee semen <1) 117 proceedings of, how proved........sseeeeeeeeeeeees eitects: Ul, 100 BONDS: : when leave to sue UPON NECESSALY.......eeeeeeee wewsaeae ss Ay 94 d allegations in actions UPON. .... 6.6... eee ee cee e eens ee «64, 815 See, also, UNDERTAKINGS. BOOKS AND PAPERS: See DtscovERY OF Books AND PAPERS. production of an examination of party......... sees ee eeee ii, 15 INDEX. 511 BOOKS AND PAPERS—(Continued): VOL. PAGE by whom retained after examination..... witbievewels'seeieaers) UH; 23 of corporation, how production compelled on trial........ ii, TV of foreign corporation, see FOREIGN CORPORATION. notice to produce..............eee ues shiaigeeete tee ceas, Hl, 92 admission of genuineness of........... Se eee ae ce 95 request for such admission........ sipie nie We eines enero er Aly 95 effect of refusal upon such request....ccccceceecveees il, 96 BREACH OF PROMISE TO MARRY: allegations in action upon...... Sides sage wiae see ee eiaesin A 316 BY LAW: of municipal corporation, how proved ..ccscceeceecsecees Hi, 100 C. CALENDAR: to be made by clerk «asses ccessccasccseniccsovecceeseses ly 207 how preferred cause to be put ON. .......eee cececesesece Li, 2138 how passed cause to be put UPOD.. ..cccccccccccscscesves ii, 208 motion to correct, When madle.......cccccessccceceesees ii, 222 for short causes, when made ....... Ib ss etaee Ree Metered dee: LL, 223 of court of appeals, how made. .........cccececeeeeeeceee ii, 712 PPACHCE A. oes atrewialied ine warren wiecages Setters ace U1; V4 practice in general term...............06. aig tates easels ii, 745 CANAL APPRAISER: copies of records of, when evidence......csseeeeseceeeee. ii, 87 CASE: how settled before judge of superior city court, designated to hold circuits............e..eeee Site iernycatslae se crews i, q amendment oles... cose sactsee ates ee erase suslaetestewusee Ty, 643 CASE AND EXCEPTIONS: when required ......... sce cece sree eens aceihidises aidlatelevstavecois ii, 385 on what motions case not required..... raoendias Sretav ennai ii, 386 not required to review conclusions of law only ........... ii, 387 what {0 CONTIN oscanciuwive cowed aces vs Ged Seewes stewisiss il, 387 when must appear that all evidence is contained in........ ii, 889 who must insert necessary evidence............... sweiew “Al, 389 what questions may be raised without exception.......... ii, 390 when must be served. ......... ccc cee e cece e cee eneeceace ii, 391 time to serve, how limited................ sin few aeoranaaes ii, 392 amendments of case when to be served...... ie:-$-0) 4 Saree ii, 892 how preparedses ess vi senevvesateacs siaeSctudlena ii, 892 settlement; Of: Ay 306 names of parties must be stated in .......... swiee Peels Sees” 307 what facts to be stated in.............. Soe senieddeeaas i, 809 what facts need not be stated in............. WES cacse i, 311 how: facts to: be stated dmiswiecs ecccaeeces siesetsecseee 2 811 allegations in action for account stated....... saeeeeaaeaes) 15 312 accounting ... ..... He ahs ea TA NES SIA EES escweeeyveese: | ly 313 assault and battery............0..05 iidewsesesseves I, — 318 pills and notes ............. 00005 ae seen dew 8 eee gasces 314 DONGS wea caer awed dees’ ae tieueine'ss Sede eRe eevee: 1 815 breach of promise to marry.............. Wtesaaeses 1 316 divorce............ Re ee smaw ana Ih 318 COWEDsisncwnn iewewees Jigewses ae sean was sivde vanes Ty 318 ejectment............. sae wiaee Meieweee issues. Th 319 fraud, facts constituting it must be stated in.......... 4 320 injunction........... Sjoeecute ape Ebieis cos ritacine sees: : ily 320 slander and libel ............-..02c008 Bee esase 1,900, OSL malicious prosecution............-.+06- Sidugsa lasaictera londsds i, 321 PATO Taco vic acs aing sea eenvwrasern eis hywia Siow ccuipatosagieesie dae. Xe 322 reformation of instrument............ Stave vam puath oe I, 824 WALTADLY vaca danun gemamasseaeaae wi tsinwialaieahieges i, 826 work and services... .cscseec ee ee eaees see ceat ects: 1; 826 assignee, how appointment of allegedin..... .. ..... i, 313 banking associations, in what name to sue or be sued.. i, 814 consideration, how and when alleged ..........-..... i, 316 where corporation, party, incorporation must be alleged... i, 317 when allegations of demand necessary in..............+5. i, 317 judgments, how pleaded in........ 0... eee cee ee ee eee ees 1,252, 331 notice, when must be alleged in. ........ coe ee eee ee eee 1 821 ownership must be alleged in....-..... 6.0 cece ee eee 1, 321 performance, bow alleged, when right of action depends UPON sie :e die cieicis essa ease aed ran eee eke See em TNT SS i, 323 INDEX. 517 DME cenaued) VoL. PAGE quantity and value, how alleged in.......... Mere ae aay Ay 823 representative character, must be alleged in............... 1,808, 824 scventer, when must be alleged in..................6. gaa. dy 824 special damages, facts entitling to must be alleged in..... i, 3825 joinder of causes of action in... ccc eee eee eee eee eee sratee Ly 827 actions arising on contract .... 0... cece ee ee eee wien Ay 332 for libel or slander............ aikjeie esi cle ea ciealelg ee eras i, 832 for personal injury........... siavel sh avavsireie dies ieieaw ee i, 882 for injuries to real property. 0.0... ...ceseee cece eens i, 333 for injuries to personal property.......... cee eeeeee i, 834 for ejectment.s esac cies cincededes Basie sarees eahees i 333 to recover chattels. ...........04 Sie SER me eNS i, 835 upon claim against trustee... . 6... eee ee eee ences i, 335 claims arising out of same transaction..... a8 sextet i, 336 what causes may not be joined in............ cee eee eee i, 338 demand for FUGSMENE « isccssisig siowicas Hake eyeled Geb ed dese i, 340 what relief may be demanded................. 2 cece ee eee i, 341 where no answer, only judgment demanded to be ranked 4, 341 what judgment granted, where answer interposed......... i, 341 demand should not be vague or hypothetical.............. i, 343 demand, does not necessarily characterize action.......... i, 344 demurrer will not lie to demand in.............. cc... ee ay 344 costs need not be demanded......... ce .cccceeee vee ease, Oy 344 interlocutory and final judgment may be demanded....... 1; 344 where injunction sought, it should be demanded in....... i, 845 when and how to be served.............. PA rabeato mide g aly 845 consequence of failure to serve ...... 2... cece eee ee ee eee i, 346 when discovery granted to enable party to frame.......... i, 681 grounds of demurrer to, see DEMURRER. See DiscovERY OF Books AND PAPERs. when dismissed for neglect to proceed ............... ii, 176 dismissal of, on opening of counsel................ eee ii, 266 in ejectment, requisites Of......... 0... ccc ceee seen ee ee ees iii, 11 ID PATltLOD: +127 -amecaislamnaseiensccs dae hsee a meninesecensles iii, 39 in action for foreclosure of mortgage.............ee eee ee iii, 112 in action for dower...............eeeeeeee SP eceivhasetaiers Hae iii, 93 instrict foreclosure sg.iweii wees tle ess odo S Pa eetieeens iii, 185 in action to foreclose lien on chattel.................0000- iil, 188 in action to determine conflicting claims to real property... iit, 145 in action Of repleVibjasisces coeeeeceeseeaason wediewees ili, 175 inaction for divoreé. ccs. weused va wee es oe eee ba Wi Baa cs oe iii, 217 in action by or against corporation............00.00..00- iii, 258 in action against next of kin or legatees............. 0... iii, 303 in action against devisee or heir-at-law ..............0.00. iii, 308 in judgment creditor’s action ... 22.0... ce eee eee eee ees iii, 833 in action against joint stock association.................5 iii, 850 in action against member of joint stock association........ iii, 352 in action to charge joint debtor not summoned............ iii, 370 in action against usurper of office or franchise ............ iii, 888 518 INDEX. COMPROMISE: VOL. PAGE when defendant may make offer Of .........ceceeseeeeeee 4 626 may be made in any action........ aise eit dsesustesseiace 745 627 when judgment entered on, will be set aside............-. i, 627 must be accepted within ten days...... use weg suneaaeeesiis. 15 627 Offer Ofavinek iveieseae iis eae an oe ie base sia sislste sistowietviens. Ly 627 how made, when more than one defendant.............06. i, 628 signature of party to offer, how proved .............66 we ib 629 how proved if made by attorney.......... sieaanwevesie — Ty 629 offer of, operates as stay of proceedings........ Ae sissies, 629 when plaintiff may make offer..............06.- sepa wetiae. a, 629 acceptance of offer, how made. .............eeeeee seven vals 630 action does not abate after acceptance of..... ove catavanuisisvecsie? Pally 675 if offer refused, cannot be given in evidence.............. i, 630 effect of, UPON COStS....... 6. cece eee ee eee opie bie neerevete ly 630 i judgment roll on offer, may be amended..............+-- 1,629, 637 CONDITION PRECEDENT: how alleged in pleading.............cescccesccccceccseee A, 258 CONFESSION OF JUDGMENT: for what purposes judgment may be confessed............ ii, 628 not to be confessed for a tort..........eeeeeeee sewineee ts « ‘di, 628 who may confess judgment ...............00006 wiecesee “ll, 629 infant or person of unsound mind cannot............. ii, 629 trustee Cannot... .... cece cece eee eee eieheecreie oatieneas fotaa dl, 629 joint debtors May......... cece eee eee eee e eens aie dl, 629 statement for, what to contain............ cece eee e eee eis Aly 630 may refer to schedule attached. ...........ceeeeeeeee ii, 631 must contain facts in all cases..........0 cece eens Sete ay 631 must be signed by the defendant and verified......... ii, 632 form of verification ON. ........ cece cece ee eee eee ii, 632 may bev amended ig: c: sau ceineshetoaawteecence sees ii, 682 terms of such amendment..............cceeeeeee ii, 633 in what court judgment may be entered.................. ii, 633 in what county to be entered .............0eee ee eee ste, Sly, 634 jiow'to be-entered) s. Ll, 148 effect of.... .. 9.9 RG WANS e Aig Pesan save Naleoeahnerrewinwegts Ay 149 new trial in.............. oe Bias teidlale edie atorscarnisiescane suite emave Ll, 149 against claimant of ower........seeee ceceeeeeeoe oes » iii, 149 68 538 INDEX. DEVISE: VOL. PAGE when judgment against bars action against executor....... iii, 290 action by creditor or decedent against ........... scmbrecieiere, HL, 299 DISABILITIES: under statute of limitations. ............ eiiety sieteivaere ys s'eig'ee 1-68, 82 must exist when right of action accrued... .. iasscaire Vea teteteies i)! 69, 82 in action for dower....... sien Wricetouslawwig gyejesie Cini wine seieteees ly 82 DISBURSEMENTS: what allowed in costs............0.% bes silane ~Heeieters Guha Le 523 only allowed where party entitled to CoSsts........e.e000% . i, 523 witness fees, what allowed as...... aia ia ve ciate Se euiein 4 adele seceees 11,523, 524 referee’s fees, what allowed as............ oeewaweet soeee 11,525, 526 what fees taxed, of commissioner to take testimony....... ii, 526 not taxed where party the only witness examined......... ii, 526 for copies of papers......... Bite sare wee ere ec Said Seeecesanes ii, 526 for searches............4. i tersietepare nee areas de eisse wee segeres TU 526 for orders...... wine alareceieves alate SDS Hane beadelges musvers seisemreevle 11,526, 527 fOr PRIMLINE. 45:00 Ses taweaces ayarius deka Wiaselas “oraperscoreaewes Ay 527 for stenographer’s minutes...........e.2e008 susidiseied exbiaceceierd ay 527 for sheriff’s fees ..... sie caahciaiecene epee eae aw avers steve taducsvere ii, 528 for service of papers.............040. bsetitie eros Was eres s ii, 528 for surveyor’s fees not taxable. ........ cece eee ee eee ween ii, 529 how stated in bill of costs............. Sbjalasgratir a anaeseralsiedens « ; 529 affidavit of, what to contain. ........0.. 0. cece cece ce wees ii, 537 of attendance of witness, what to show........... eis UNs 537 of referee’s fees, What to ShOW.......... cece ceeceees ii, 538 not allowed without affidavit...... CEUASSKRR ERE ES ERe See ii, 537 DISCHARGE: defendant must be, from arrest, on giving bail, or deposit.. i, 429 of bail, before expiration of time to answer............0.. i, 439 DISCONTINUANCE: attorney may stipulate for. .............0.4 Sseeis name AR e- 29 effect of, on limitation of action, where counterclaim inter- POSE Ciss.s.dincnavnacscaapacantsieia sia eisrava is iD ee sea AS OS TE asvees Ty 82 when allowed........sccccccscesceurs Siuiteiscechaunsys sigue eets i 152 right to absolute before appearance ......-... sees ay ese A 154 allowance of discretionary... .........6 cece eee e eee eee li, 153 LELMS) Ofeiccn once WReaceein Magee Recacvewmae eee wi wewe ii, 1538 granting of terms,discretionary...........- (aeavscawe Ul, 172 what terms required..... 0 cseseccceee ce erens ieeapece Hy 172 when allowed without costs ...... wie Sze ea eiee cee ii, 178 upon settlement of action ...... cee cee cece eee e eee ee ees ii, 154 after counterclaim interposed... ...... cece eee eee nero ii, 155 upon plea of another action pending .........+.+e+ee06 +s ii, 157 arbitration Operates AS... 6.2 cece eee ence eee een ee ees ii, 158 after change in rules of practice ......6 0... eee cee eee eee ii, 159 in action for replevin .... 6.6.00 ce eee cee eee eee ii, 160 where plaintiff has heen misled. ........ 500208 Seas tees ii, 160 where plaintiff surprised by defemse...... cece eee ee eens ii, 162 ii, 161 in action of ejectment.. 6... cee eee eee eee eee eee INDEX. 539 DISCONTINUANCE—(Continued). VOL. PAGE where witness has been examined pending action ......... fi, 161 where action brought under mistake ............00. eeeee li, 163 not allowed where plaintiff in default........ Pica seadraem: ly 164 order for, how entered on stipulation.............00..0002 il, 164 application for, by whom made.................ee eee eee ii, 164 may be made at any time before judgment .... . seaee Hl 166 should be made promptly..... eudseesewe ss sesseemiie: Hy 167 what proof required on. ......... ficsa san swannpien Hy 168 what facts should be stated in affidavit on............_ ii, 169 when notice of motion for required...............-.- ii, 69 opposing affidavits On. ..... cess ceeeceeeeeceseeees — i, 170 order for necessary to effect. ......ccececeececeeeereceeee iy 168 CONN OL sic nusawion cxwneaged warnetesa ns aistatceetiaiese> Wy 171 must be complied with lefove effctual......... seen ii, 172 COC OL a. deseuxsaturs sian cele ieee eiee aia aelians sieeveschseusie » “di, 174 rights of defendant after...........cccccecccsecessceccee il, 175 for neglect to proceed......... aad eataee sabingies es wee Uy 176 DISCOVERY OF BOOKS AND PAPERS: what courts may order.........-... sees eee ene teemeeisaw ly 677 application for must be made under Code of Civil Procedure, i, 677 must be by petition..............566- siaastetenete Sites. nike, dy 684 distinction between, and examination before trial.......... i, 677 granting of,discretionary.............. .. a atetenni aie ane i, 678 must be necessary.......---+ sep g ears ea teen cat i, 678, ‘679, 683 includes power to compel deposit for inspection...... eteeeys tly 678 only granted to enable party to obtain information neces- sary for his OWN CaS€ . ......-. ce cece eee ene wigtei stored eo 678 when not ordered of all books and papers........e.e0e000- i 679 may be ordered of books and papers of corporation....... i, 679 may be ordered of books and papers of receiver....... ... 4, 680 when ordered in actions betwecn partners .......... eee 680 by principal of books of agent...........-.- iawebeaas, ly 680 cases in which not ordered........ ere Steismidictete ae fe 680 application for, by whom made...........2+55 siheiaiates heareres Ey 681 when granted, before cause at issue....... .s.eceeeeee »- 1,681, 682 when granted after issue. .... 6. eee eee ee eee eee eee gee es 1, 683 petition for, what must contain.............. bh BER eis NG 685 what facts and circumstances must be stated in....... i, 685 must be verified by affidavit. ........ 0c cece eee eens i, 685 must be verified by party ..... .......568- siitoeerees dy 687 when certificate of referee, sufficient proof for....... wane oh 687 order to show cause, what to contain.. ... Nauonancadanc eases i, ‘687 should contain directions as to manner of discovery... i, 688 peremptory order cannot be made ew parte.. ... wey i, 687 proceedings upon return Of .......... eee eee ee eeeee i, 689 when order will be denied on hearing of............ i, 689 order for discovery, what to contain......-......-esee0- e dy 687 when may operate as Stay... eee cece eee wetas i, 688 by whom may be vacated... . cece cece ee eee ee cee ii, 688 for what reasous Will be vacated........ cece eee eee i, 688 540 INDEX. DISCOVERY OF BOOKS AND PAPERS—(Continued): vou. proceedings under order... ..........4. cece eee eee sede. “Ty referee may be appointed to superintend...... ...eseeeeee Uy power of referee... . 0... cece eee eee eee achereeatene Laveswisiaveas CL, order should be strictly obeyed... 1... 2... esse eee wasawer Ty how obeyed in event of party not able to produce...... gee 5 party may be examined under oath before referee......... i, when part of books may be sealed ...... .....04 Seiciensaar hd how sealed portions procured to be opened........+.. i; proceedings, if order not complied with ........... isiainacs i, effect of papers produced as evidence............. wiemaes ly penalty for disobedience of order. ........ceceeeeeeeeeees di same time to plead, after execution of order for, as at time DISMISSAL: of complaint, for failure to serve summMonS.......-..+.--. 4, for unreasonable neglect to proceed......oeeeeeeeeees UL for neglect, when defendant waives right to move for, i, defendant cannot move for, if counterclaim pleaded... i, for failure to serve copy, when granted .............. i, effect of judgment of............... yeGierd Niereia wiele eistaistesete or CAs DISMISSAL OF APPEAL: See APPEAL DISMISSAL OF COMPLAINT: for plaintiff's neglect to proceed ........eceececcceeccoees Hl, DISTRICT COURT OF NEW YORE: appeal to court of appeals from action commenced in...... ii, appeal from judgment of............ seedeeie Hee weaRRS ii, See JUSTICE OF THE PEACE. DISTRIBUTIVE SHARE: action for, when brought against executor..........++.+-. iii, DIVORCE: notice published with summons, in action of.............. 4 what must be alleged in action for.... ... syasecalaraleiese sjaledose’ ay counterclaim in action for. ........ cece eee ene aoa eiaveennice i, place of trial in action for.......... «ss... 3 tavendiid desis ii, actions for to be tried by jury .......... ce cece eee eee ee eee ii, what must appear in endeavor to refer........... 6.22.04: ii, judgment in action for not to be entered without order .... ii, when judgment for money in, enforced by execution...... ii, action for, see MATRimoniaL ACTION. DOCKET: of justice of the peace in adjoining state, how proved...... ii, of judgment ........... cies nA, ole aE SIR 8 Hine enters. © ae eR ii, effect: Ofc. cecsec cuss cee sansa scan auns Guile Maes Gunna Ameena Ly when to be cancelled and discharged..... ...-... eee ee ee ii, entered on return of execution... .. 2. cece eee ew teen ee ii, of judgment on restoration of lien... 2.06... 6. cee eee ee ee ii, of judgment by confession ...0 2. ...s90s seenine i weawoe ii, of judgment, when amended or canceled after anneal olttites ii, PAGE 690 690 690 690 690 690 690 690 691 691 691 688 240 240 241 241 346 241 176 694 764 284 172 318 368 117 188 352 565 786 105 569 870,571 585 587 588 634 683 INDEX. DOCUMENT: VoL. congressional, admissible as evidence.......seeeseceeeseee ii, in public office of foreign country how proved............ ii, DOMESTIC CORPORATION; Cenhed ccGn Gaasiewale wats ews eelba es See Saeeeweaweuwe's dily See, also, CORPORATION, DOUBLE COSTS: See INCREASED Costs. DOWER: action for, when to be brought......... pba REiereeerk |g disability, in action for............ ...0. 0 jubveonsssueer aly what prevents running of statute of limitations........... i, who defendant, in action for..............45- seh siemens Cs effect of notice of pendency in action for.......... Serene Wy allegations in action for...........005 ceeeeeeeesceroes s,s undertaking required on injunction to stay proceedings in, i, action for, in what county to be brought.... .... eaaesedees “Il LO: Deitnled, Dy JULY: ncrstwietidec coe rastas cases Oe westisvert, “H fees of surveyor in ............ Seen CR CRreREre ore retin t ii, fees of commissioner in ......... cece ee eee reece eens fee Te judgment in, enforced by execution.......... .....- veis'e, ly court to make disposition of in partition........ cmgeweeen lly inchoate may be-released in partition................-. iii, how value of ascertained. ............cceeseeeeee iii, admeasurement of, see ADMEASUREMENT OF DOWER. E. EASEMENTS: when encreachment upon, restrained........seeeeeeeeeeee A, may be recovered in ejectment.............. itiesioaedcewion Ll, ELECTION DAY: courts not to be Open UPON. ... cecsesecscccccerecceeeees A, ELISORS: . when and by whom appointed .......0....ccceeeceesesees FT EJECTMENT: proof of authority by attorney to bring...... Bo eealonedes i, who may be plaintiffs in............ srs ielsisinesiaseiey area a TAC i, by grantee under void conveyance..... did dla wits sete sige eats i, who moust be defendant in... . 22... eee cece eee eee cence i, when person claiming title may be joined as defendant in, i, notice of pendency must be filed in action of..... ........ i, effect of such notice .... ..cccec cece eee ceeereeneee i, allegations in action for...... 1. seeee eee cence teen eee i, undertaking required, on injunction to stay proceedings in, i, does not abate by deaths: .sicu dees occwndonedees ees ees's i, substitution of partivs in action for, eee Me grantee in name of grantor ...... -....- obbe ei continuance of action for, by Mionane rienants incommon, i, when grantee of defendant in, need not be substituted..... i rules for substitution of parties in...... BGS fi se Sie ices as seceaanaaict i, 541 PAGE 102 107 249 63 82 83 131 185 318 490 110 187 548 548 786 76 U7 21 28 124 126 126 127 182 184 319 490 661 664 667 669 671 542 INDEX. EJECTMENT—(Continued): VOL, PAGE in what county action to be brought..........sse-eeeeeeee ii, 110 discontinuance in action Of.........e.eeee08 Gina) die eidintele vierwies AIG 161 action to be tried by jury... 2 sccccceccccccsecceeserecs li, 187 verdict in action fOr... siccsecisaerseovsesuvee giatscare stele ees US 821 motion for new trial in.............. cece cee Sire led oad ses ii, 431 when a matter of right by statute............ enews ii, 431 when discretionary ...........66 Mingo wes SV OS Few sls ess ii, 432 in what actions not granted................-. 5 dace eis ii, 432 what must appear on motion for new trial in............. ii, 432 what must appear on motion for second new trial in....... ii, 433 proof on default in application for judgment in........... ii, 599 on what restitution ordered on reversal of judgment in.... ii, 690,691 judgment in, how enforced by execution................. ii, 786 leave to issue execution after death of defendant in........ ii, 795 origin and history of.. .... ....... nibea eaaco Sevan ae eaiesare Ally 1 what courts have jurisdiction Of...........ceeeeeeeeeeees lil, 2 for what the action lies............. wsateie sts siiieve@eveaceeer dls) Op of Jane. Under Water isccisicajsies cis eis icscise5s Siey oes 1 ¥ ols see e's iii, 3 highway.........- aiioxdewtagaises aisals ares teicteigedtatuete ee iii, 3 CASCIMCIIE wea na e's Mawes see se see GeddseeoRene ewe “Mil, 4 when maintained by people.......... cc. eee cece cere eens ili, 3 on what title may be maintained..... sean wieWiawivie a” eee. HLL, 5 plaintiff must have right of possession................ iii, 5 when maintained on mere equitable right............. iii, 6 possession, how far evidence of title in................ iii, 6 may be maintained against vendee under contract..... iii, 6 mortgagee cannot maintain......... 2... eee eee canes iii, 6 what may be recovered in......... see eeee cece seeeevewws Hl, q rents and profits...........2eesee ween spadecnpale ahi at siets iii, q damages for withholding property............-.....- iii, q permament improvements may be set up against dam- ABER Shea d ehhadhrasantceangsee airs aimee Win cniatay ore nalavananess iii, 8 who may be parties in............. winieeeldins eeseeuweents iii, 8 PlAWMEHTS ain cc sas ced oe 9 24 Sree eae abe Bareue alae any iii, 8 committee of incompetent person or lunatic........... iii, 8 receiver ...... arene: baw Ba aierod areas aul Bees ww eunemeals iii, 9 TWUSECC sees aes eae serses oes SMe rte eommareae iii, 9 who to be joined as defendants ...... avertcacarmieseree Neabtors Oa iii, 9 when action severed by several occupation ...... ........ iii, 10 pleadings nisi: ie seeeein ciees Gia aeee eres Der saa eases iii, 11 complaint, requisites of....... . wig e-w Spiele ea s toute Wiel iii, 11 against tenant in common.............. Seaiarausperarear MULLS 11 against joint tenant..........+ sab heatebie se enean ger IL 12 COMULLED. cc sacd wees: Wow stoi wane n coy pe eaca dew eos Aly 13 ANSWER ieiccrd cosine Aas teas BS eee ees chy ee cee wea ey fii; 13 what may be proved under general denial ........ iii, 13 equitable defenses may be alleged in.......... eae Mii 14 proof of authority to bring action of........ eas ee seeeee iii, 14, 15 what: SUPICIOM bes sr canis Pome see eee He ‘eed deen sc Ally 15 receiver, when appoin‘ed in........ MeWAReesEseRoase ys “1, 16 INDEX. 543 EJECTMENT—(Continued): VOL. PAGE injunction in...... cece eee ee eee eae Na see Sae pervect 1; 16 survey, when may be ordered in........ occ ceeveccsences iii, 16 order for, what to contain........ Peer cere or seeara Ml, 17 how property specified in.......... cc. cece sees eisiaisiacy Alls 17 order must be served before entry...+++.....eeeeeeeee iii, 17 how made after order. ......... cc ceeccsecececcessens iii, 17 proceedings before judgment in.......... ig eis iss sioseaee dil, 17 issues in, HOW tried ws.cccece aavedsssvoss ease vain cciarasaee iii, 17 estate of plaintiff must be specified in verdict, report or de- CISION GAG eae ne uae alae aa magia Oa wie Oe Rare yAE Ss avers iii, 17 estate of plaintiff to be stated in report of referee.......... ii, 821 estate of plaintiff to be stated in report of referee.......... iii, 17 verdict must state estate of plaintiff...............00.000. iii, 17 how rendered when estate of plaintiff has expired..... iii, 18 JUGEMENE IM. sana saesiseess owas o Use sinew os sae simecinis © iii, 18 POPMVOL eavooxietsea ee see Mesa wees Coe eae spawns asieeveiee iii, 18 estate of plaintiff to be specified in........-.......... iii, 19 CMEC OF sccscndan dee swears sesesats Se asiees stewie weitere, Uy 20 when Conclusive, .......ceeeeeeceeceoee wales isla ass iii, 21 against whom conclusive. .........-seceeeeeceeeacece iii, 21 COSTS Tis wakariine, Demadtiensee.caet oes ay hii aretirayatoce tsiaca eS ii, 454 new trial, what defendant may show ON............000008 iii, 19 when default opened in.......... cece ee eee ee cece cc ceees iii, 19 proceedings, when brought for rent, in arrear............. iii, 22 when may be maintained...............0000. cceccece iii, 22 notice to quit, when not necessary.......- aeeidisowive sie iii, 22 notice of re-entry, when must be given..........0.e6 iii, 23 amount of rent due to be stated in judgment.......... iii, 23 when rent apportioned ss 666... css cesievee secwosaesees iii, 23 payment, or redemption by tenant..... ....... seekes iii, 24 when possession of property delivered to tenant....... iii, 25 EJECTORS: action against forcible ejectors...... dieasswelemesecwaseensn: dy 163 ENTRY: upon real estate, when sufficient asaclaim... .. wenswesen: Ay 64 EQUITY: jurisdiction of supreme court, what it includes.......... ee aly 40 actions in, when barred....... ceeseseen oe eens cecceeee 1 %6 ERROR IN FACT: motion to set aside judgment for, see JUDGMENT. ESCAPE: limitation of action for...........eee008 Wiepedesswanesdee Hy % ESCHEAT: people plaintiff, in action to enforce .....-..-. dalsisietwagees ae Ath 820 object of the action...... 0.0... cece eee eee cee tence eee iii, 320 how far replaced by supplementary proceedings........... iii, 320 572 INDEX. JUDGMENT CREDITOR’S ACTION—(Continued): VOL. PAGE kinds of judgment creditor’s actions .......-.... 0.04 . «+ di, 321,828 what are equitable assets.... 2.0.2.0... cee ce eee eee eee eee iii, 821,328 may be brought to reach trust for benefit of judgment MebtOrycaslees sysare abe deededaakuida Sieleisemeienn ating « iii, 322 when brought to establish liens on lands conveyed to third person......... (NAP ORAL Rama eRe sey erase iii, 822 may be maintained to remove obstructions to sale by execu- HOM: ccceaciemeeh sna ca ee aead soem. S85 Reese: Sete iii, 323 not maintained against corporation........ .......ee ee. iii, 324 how far regulated by statute....... 02... cece cece eee iii, 824 remedy at law must be exhausted...........0. cece eeeee iii, 324 mere contract creditor cannot maintain. ........... ....- iii, 325 judgment must have been docketed...............0 eee eee iii, 326 when maintained on judgment against joint debtors....... iii, 326 judgment against executor, when not sufficient to maintain BC LLONY. aireralaraler sare esa ratsboaluncledstoa.eah Uy 4 what cases tried by.... 2... 62. Lecce eens copirosienies ene Aly 187 how right. to trial by, waived...... eames ae davy ecleauciees aay Ub 192 struck, see StRucK JURY. foreign, sce FoREIGN JURY. how drawn on trial.-... 2... ..e.eeeee LEB duPicaatoncdesk- Aly 250 consultation of, see TRIAL BY JURY. 574. INDEX. JURY—(Continued): VOL. PAGE new trial for misconduct of ......... ieee caeeae «aeons U1, 403 on writ of inquiry.... ....... . Semele ai Litho eoasts seems 1} 602 judgment, after trial by, of specific questions of fact...... ii, 613 JUSTICES: of supreme court, to appoint terms and circuits........... i, 6 NOE GO: PYACHCE: ic cae eee ae eiies oan wane Piveveleviaisenta: dy 12 POWCTSOLL acca occ uiterutewnsteett baneeemnws siete oy 40 what may do, out of court.......... salts seeaerciaadss waggle Ooh, 57 when may make orders in action in county court...... i, 58 JUSTICE’S COURT: limitation of actions, upon judgment of.. ....... neereae Ih 70 JUSTICE’S COURT OF A CITY: appeal when taken to, court of appeals from action com- MENCed! Wk 'oos.g e355 Has sa a ER wititise inode bisia eabhec Io ene HG 694 JUSTICE OF THE PEACE: docket book, of what facts evidence........ ... ith paeednces ii, 100 transcript of docket of, when may be read in evidence .... ii, 100 proceedings before, how may be proved......... Dect ii, 100 in adjoining state, proof of proceedings before............ ii, 105 costs of plaintiff, in actions of which no jurisdiction ...... 11,458, 461 costs against, in action for false return ..............0005- 11,461, 462 transcript of judgment to be furnished by................ ii, 570 appeal to court of appeals in action commenced before.... ii, 694 who may appeal from judgment of .. ......... eee eee eee ii, 763 judgments of, only reviewed by appeal ..... snlshien eats ii, 763 what judgments may be reviewed ..... ... ee cece eee ee ee ii, 7 to what court appeal may be taken ........ Sap ees es waste lly 764 when appeal must be taken ..............0.46 ais Seavaieeiedies ii, 764 when notice required to limit time to appeal ..... siiweaate al, 765 how time to appeal computed ............ 0c. cece eee eee- ii, 765 notice of appeal what to contain...............5 dSfasseacetees ii, 765 by whom signed. ... 2.0... cee eee ee cee ois Sestersceser Sawer ii, 765 when undertaken must be served With .......ccccececcces ii, 766, 763 upon what notice to be served ........... viewitecieseso dy 766 how served upon respondent ..............008- Sire Bedicies ii, 767 payment of costs and fees upon serving ... .............- ii, 766 what defects upon appeal may be amended............... ii,767, 768 security to perfect appeal ............-.66 eeeecees aisisrstu'gs. Sly 768 HOrslayCXECULION) waa. series See easeadaandelameadactautss il, 768 requirements of undertaking .......... 0... cee e eee ii, 769 serviceof undertakings. ci cccce sane ev keeeseeeeasenes ii,769, 770 when proceedings stayed DY.......... cece ee eee seine Hy 770 justification of sureties. «22s. s.csccuesaeawesas veasees ii, 770 filing of undertaking when justice cannot be found... ii, G71 return of justice when to be made ............... 6 0.00, ii, 771 what to contain. ..c2.0.s005.40ee0.0e ee ne taees cies ane ii, 772, 773 errors of need not be specitied in notice........ azcmeee iy 776 liability of justice upon. ...........e eee ieiesweee i; V2 process must-be returned with.............., oe saves oH 773 INDEX. 575 JUSTICE OF THE PEACE—(Continued): VoL. PAGE notice of appeal must be attached to........eceeeeeee Li, 173 further return when may be ordered..... eweeeew ees ly 773 proceedings where no return can be had.............. ii, 774. when appeal may be made upon affidavits ................ ii, 775 hearing when error of fact alleged............ eweceee seen! ly V5 what questions may be raised upon appeal.......... seeees 1,775, 776 principles of determination... ......... 2.08 deena ayaa a dont ii, 776, 777 for what errors judgment of will be reversed.............. ii, 777 when judgment by default will be set aside...... eevee a1 TTT defendant must show good defense ........ .... eteontae Ie 118 what papers used on hearing ............ cece ee en eee tame Uy, 778 at what term hearing may be had.............. seseeeawe ITB, 279 what judgment to be rendered on appeal..... Svea enim AL, 719 judgment of, may be modified on appeal............ wae caw 2,979,780 judgment where new trial directed before ............... li, 780 judgment-roll on appeal....2..... ccc eee eee eee desteswane T780781 restitution when will be ordered......... .eeeeeee Seales. Ul, 781 when new trial may be had in county court ...... iemoeaies ii, 782 right to, determined by pleadings... ..........ee cece eee ii, 782 when action deemed in county court. ...... vars tou abeiannealal oie ii, 783 jurisdiction of county court, after appeal............ i Stakes: Ly 783 what amendments of pleadings may be allowed..... seoeain al; 784 when case may be put on law calendar. ....... Siteopt 11, 784. compromise after return .......... feces eee eee weerseaiwis: dl; 785 L. LACHES: what excuses, on motion to vacate for irregularity..... .. 4, 652 LANDLORD: when possession of tenant, not adverse to..........eee00- 1, 68 LEAVE TO SUE: when necessary............ 000 Diwieweieweeeee ceed Weeawees, od 91 in action on judgment............ sisuaraeid atece 5 isiasiarsieralolernal) oy 91 in action on mortgage...... ida! ia Socata techn sfesectile wianeistaney’erate® 5 93 in action on official bond..... 2. wk. cece e cece ee eeeeees i, 94,234 in action to dissolve a corporation.......... wieie Basie reece i, 96 in action by recéivet:.1.csceses soa sees eecycseseen ste; 98 in action against receiver........ 06. cece ee cece reece eee i, 99 in action by or against committee of incompetent person.. i, 99 in action of partition by infant ............... eee eee eee i, 100 OS POOP "PCFSOD iiss eae saan enare eeesaes areas Gieves ep ast i, 101 when party may have leave to defend. .. ........0.eeeee i, 103 receiver, must be obtained from court..........0eceeeees i, 587 LETTERS PATENT: HOW Provedl.c.cisvnadgnirra ls hb Ree oko a.nd ous MatyeeeRte sess Hy, 102 action to vacate to be tried by jury....... ... siésajmialgveisratares dy 188 LEGACY: action for, where brought against executor............ sacs lil, 284 576 INDEX. LEGATEE: VOL. PAGE action by creditor of decedent against...........+++++* ws tii, 299 LEGISLATURE: See, also, DEcEDENT. when may take away franchise from corporation........-+ iii, 278 LETTERS ROGATORY: WIEMISSUER 4.’ 5a caitidstciak MATERA SENN Sie ERTASIAS ii, 37 only upon written interrogatories........ cesses ee. Siiesis'ss HD 37 : See COMMISSION. LEVY: See EXECUTION. LIBEL: rule for pleading in................. RGN Boks seececeee 3, 255 when publication of, restrained by injunction............ i, 469 examination of party in action for....... Bare secemidiaistauaeersuocats ii, 4 LIEN: of attorney for serviceS............00cceucceeceeee seeee i, 30, 31 of attorney, whether notice of required...,...........0+ « dy; 32 right of parties to settle without regard to..........+ a dy 382 how may be enforced........-...0c0-cececcuceeeeees i, 33 of one suing as a pOOr persON..........eeceeecseeeee i, 34 of judgment, See JUDGMENT. in partition, how ascertained........... iiewwdwed deceaunte iii, 44 publication of notice for..............008 Se¥e shes eG aes adesat iii, 45 amount of, how to be paid in partition............ Heanerees iii, 78 application for payment of, by whom made..............- iii, 18 upon whom such notice served............ wee Sac iighatage iii, 78 how moneys to be apportioned.......0 66.0. cece eee eeeeee iii, 79 on chattel, action for foreclosure of ............. weeeeee iii, 137 when and where maintained............0.eeee eee eeee iii, 137 proceedings in action ............ ec cece cece ee vee . iii, 138 complaint, what to contain. ............... eco ee ew Ble 188 when triable Dy Guryiicies eee tian swsegines cenezeaa eee ili, 139 final judgment Int nosy cans oes e ease eee ren isecwme es iii, 1389 What tovcontalny os. sc.s ces sees eeeeaeae emmetics iii, 1389 sale, how to be made........... ec eee eee e ee weer cence iii, 139 seizure of chattele in: sc scc cose as eeveve cae eey omnes iii,139, 140 proceedings on, in courts not of record............... ili, 140 of plaintiff, in judgment creditor’s action................. iii, 336 in supplementary proceedings by service of order......... iii,488, 439 LIMITATION OF ACTION: includes special proceedings. .......... 0... eee eee ee eee ee i; 88 by people for the recovery of real property. .............. i, 62 what adverse possession bars people. ...........00.00. eee i, 62 by party other than people, for recovery of real property.. i, 63 Te. an ae ke Oe - emia wid aoe WER, eee CLG i, 63 when limitation begins to runs against real property... ... i, 63 entry, when sufficient as a claim... .......... cere eee eee i, 64 presumption of title, 0.0.0... cc cece cece ee tee ee ee eeeee i, 64 occupation presumed to be under legal title.............., i, 64 possession under written title, what included in........... i, 65 INDEX, 577 LIMITATION OF ACTION—(Continued): VOL. PAGE when deemed adverse... 2.2... eee cece cece cee eee i, 65 possession not founded on written instrument, what in- ClO, Gg eis'y-cccsss vein shepile BEEK GES REA ee aoe ated dietenncree 15 66 when deemed adverse............... cece cceeeeceuces 1: 66 possession without claim, not sufficient...............00.. i, 67 when possession of tenant, not adverse to landlord........ i, 68 right not impaired by death of occupant.............. spay al, 68 what disabilities prevent running of the statute........... i, 68, 82 actions other than for the recovery of real property........ i, 69 judgment or decree of court of record.............05. i, 69 presumption as to payment of..............0000 i, 69 how presumption overthrown.............eeseeees i 69 how presumption of payment pleaded............ i, 70 to redeem from mortgage, when barred.......... Sistetes Waly 70 on sealed instrument..........0. 0... cece cece ee ee eae i, 70 for specific performance....... 2.0... cece cee eeeeees i, 71 to enforce payment of legacy charged on land ........ i, 71 forty years, what actions barred in................... 1, 62 twenty years, what actions barred in...........:...08 i, 68, 69 six years, what actions barred in .................-. i, W three years, what actions barred in... ... sis crraeidiextions i, 73 two years, what actions barred in..............08 eee i, 74 one year, what actions barred in .............00. sites NAG 5 ten years, what actions barred in.... .......i ee eeeee i 76 on contract, when barred in six years.......... idle lenses i, 7 against coroner or constable........ 6... ec eee cc eee scenes i, 78, 75 for penalty or forfeiture ...................- § Gale vain Rees i, 63 to the people..... ...... .. eee aud G49 TEER AGRA 1, 74 Piven! tO TNE! PYOSECUION sce xiaw ers 535 6: 510d Kio tederece gies i, 76 against executor or truste@.......-..... scene Piaisnd etc Sioabaia i, 78 POF HECMBEHCO a. ea acinadnit poeta pk RTA Namen ed ER Roaes i, 73 for personal IijUTY cas aes conse bacon bole eidabaans 1; 94 for death by negligence.......... 0. cece ee ee ee oi Cavbiayecs elds i, 15 to annul a marriage 10... cece eee c eee eee Havana i, 75 TOT CSCAPC ic Gia avs eeaws Peavey maes dlapaiaehSaincupimebe ey i, 75 to recover strays seized on the highway ..............-... 1; 76 to recover excess of interest paid ............e. cee ee eee i, 16 against trustee, for debt of corporation ...... sess NSE Te 16 LOPSGUILADISTEMEL 5 2. caccdccusisues Rain de noes ah OS44's Sraary ale 1, 16 by the people for spoliation ........ cee eee eee eee eens i, 77 applies to the people... sca. sscwisicas. cavensacmy woes i, vi for claims against the people ......... 0... cece eee eee eee i, vu against non-resident ............. 0 cesses cece enero i, 78 against foreign corporation..... tewsearsearees Baas i, 79 what prevents running of statute.............0 00 wearonets i, 79 where defendant dies without the State ............-.--2- i, 79 between death, and granting of letters ....... yaya iateua de cauauise i, 80 where plaintiff dies before expiration of time............. i, 80 against executors or administrators ...............0..000- i, 80 73 578 INDEX. LIMITATION OF ACTION—(Continued): VOL. reversal of judgment, when extends time of...........00 1; when extended, by submission to arbitration ...........+. i; discontinuance, effect of, where counterclaim pleaded..... 1; what actions not within the statute ...................06- i, computation of time under statute. ........ 0... ee eee eee i, in action on open account. ..... 2... eels e eee eee i, by principal against agent for negligent act......... i, where demand necessary............se eee eee 4, Suatalaanee i, against trustee for detention of property ............. i: Or Ce Posts! avai Bie wcanenecanghewna i EGEE era con Dae 1, On demand ‘nOteS: os <4 cienieendied so hase eee eee Ease Is ON CHECKS. 6. snes eanaw dior dteadaduesaein see ei teen eee i; by trustee against cestud que UrUSt... 2... cc cece ee eeeee i; by surety or endorser........ sss esecccrses raaeomee A; by attorney for serviceSwccciuscc cies civa vee sees ees i, Dy PaGtOr 2 cessed Seatimtweclen iad aia deme tae wee 18s i, in conversion ..........0.0 wb essahSeue ty idie Sia anaualgite lacava tennavene i LOL TOL cassis: wise a tai utees de ke adi alersya eta taster oh eas i, against director for failure to report.............-...- i, cause of action barred, not a defense or counterclaim...... 1; acknowledgment, or new promise to prevent running of the statute, must be in writing................ 2.02 eee i, what is sufficient to prevent running of statute........ i, by whom acknowledgment may be made............. i, how statute must be pleaded to be available....... waives’: iy when general statute does not apply.......s0. ceeeeeeeeees i; when action deemed begun..............+eee08 ee eee attempt 1o commence action, effect of....... witsulosiccae: LIS PENDENS: See NoricE oF PENDENCY. LOAN COMMISSIONERS: action against, how brought............+006 She ected: see LUNATICS: how summons served upon........... see eeeee pecccccces when court may appoint guardian ad litem for..... San sie receiver in action by or against............ see cece erences M. MALICIOUS PROSECUTION: what must be alleged in action for....... ad eesteiacna Maree aera MANDAMUS: issue of fact joined upon, to be tried by jury...........08. MANDATE: Serie MUSt. TECEIPt AOL. i sedis sds se sdies seseile sieeve aie Sieieinge, eleleias ITEM MEN OF as. gussaisndiee mesa Pee e nena new anda woo Bie thinabs ieee MARRIAGE: limitation of action to annul..... ereneeengiee siaterehet is aus tethipie tele of woman, does not abate action. ...... ec ec ce ween eee ees PAGE 118 151 152 580 821 188 18 636 75 661 INDEX. 579 MARRIED WOMAN: VoL. PAGE statute of limitations runs against.......... oF Aas inie seeeia. “ally 64 MATRIMONIAL ACTION: jurisdiction of courts in................. saeoners@) deceanie Ml, 198 what endorsement required on summons in............... iii, 207 action to annul a marriage..... 0... eee eee eee ec e ees iii, 199 by married woman under age of sixteen.............. iii, 199 by CIHEE PALty cc csc masa niad are ertinesdy nakeeen iii, 200 because contracted before age of legal consent ........ iii, 201 because former husband or wife of party was living... iii, 201 because one party was idiot or lunatic................ iii, 202 where consent obtained by force or fraud............. iii, 204 for Impotency seas swisaseswsa sieve sncsay va iii, 188 fees of officer how taxed .......-.....2e00008 mieten meee iii, 187 when affidavit and requisition to be filed.............-50- iii, 188 exception by defendant to plaintiff’s sureties. .........+-+. iii, 189 rights of defendant after exception... ©... .+seeseeeeeeees iii, 189 , when property to be delivered to defendant......+-..+++-- iii, 190 what papers to be served on demand for delivery....- eeu Hil, 190 affidavit on demand, what to contain....--.> Sienieene eRe iii,190, 191 undertaking on demand of delivery.....-..- ae lansiisweataglosels ii,190, 191 sureties, justification of...........200s Sonera wecekaleer ee ill, 192 action on undertaking.......... 0.4 cesses eee teen eee eeeee iii, 198, 194 proceedings on claim of title by third person.. ......+++++ iii, 194 second and subsequent replevin, when made.....+..+.+++ ili, 196 612 INDEX. REPLY: VOL. defense of statute of limitation to counterclaim must be pleaded DY... cece cece eee eee teen e eee eee eee ees i, when plaintiff may..... 0. ...---. eee eee iis sieges ats sae Ay may be directed by the court.......-.+-- jo ebouud eee s tas i, what defenses do not require... .......+eeceee cence ee ceyt <1, what waived by....... cee cs eect ee ee eee tee eeeee nee i, what must contain 1... 1... eee eee eee eee shoe tee eae wes iy may contain counterclaim.......--+.eseee eee rece ee eens » ah judgment, on failure to...........-00- 0 iiaties easy, waa AY when waived by defendant..........0-..eeeeeeee eee eee i, grounds of demurrer to, see DEMURRER. REPORT OF REFEREE: in ejectment, estate of plaintiff to be stated in............. iii, in partition, see PARTITION. in action for admeasurement of dower. ..........sseeeee «eT, on default in action for foreclose.............. cece eeeee iii, on sale in foreclosure ss sssiccndnsenncnesdaswaveeweaies oes iii, in supplementary proceedings ............- siesstewesews I; of referee, see REFEREE. RESERVATION: Of Cases LOR trial .. 6 se.s.ees a secerecesea deepens #6 ea aoe aetna sles, Al, RESIDENT: may designate person to receive service during absence..., i, how such designation revoked......... Bint aeoaeres. eeer 1215 RESOLUTION: of municipal corporation, how proved. ..............0.2. Hi, RESTITUTION: when ordered by appellate court on reversal......... witb “A, RETAINER: of attorney, when must be in writing.............ceeeee. authority of attorney under. ..........06 ceceeeccecenene A, RETURN: of deputy conclusive upon sheriff. ..... cece eee ee ee eee OL by sheriff upon execution of process............. .eeeeee i: HOW Com pelled i ics:4 ssvaauwinu Gate oeneiaawwiuwoaneee as i, in special proceedings, where filed...............-005 seep A; amendment of..-.........0 cece eeeee oe salale alaniee sivineeeeae ody REVIVAL OF ACTION: See ABATEMENT OF ACTION, ROCHESTER: appeals from judgment of municipal court of....... ere ii, RULES: of practice, where found wi iceeeessvienedd tele eae ve os setaeeses Ay courts of record may make.............008. ied daxewaees i, 8. SALE: when ordered in partition....... Ws dleleciverse ce sesienensae I; noticerol, LOW SLY EN wsscoiwiawiaieswicmdawwaareneX seas any seed iii, PAGE 88 871 871 371 372 372 373 373 374 17 101 114 125 462 222 155 156 100 689 28 28 16 18 18 224 644 764 47, 55 57 INDEX. 613 SALE—(Continued): VOL, PAGE how property described in........... 0... cece cee eeeee iii, 58 postponement of, how noticed ..........cc.eeeeeees -.. iii, 59, 62, 121 duty of officer making. .......... 0. ccc cece e cece ec eeeuees iti, 59, 121 may ask for GNStEUCH ONS:c iar. aios hu sn odin ecm iii, 59 when may sell in parcels ............. ccc cee ee ee eeeee iii, 59 must follow directions of judgment ......... Fhe iii, 61 cannot delegate his power. ...... Goeav eee enswa ees iii, 59 when may be compelled to proceed ...............008 iii, 60 when may adjourn sale ............. eeeree eerie ee iii, 60 is officer of the court ..... eee ere re reer re es iii, 61 PIOCeediNgs UPONsy sseod Gwe dade dein ves de eeBNOEe eRe iii, 60 at what time to be made..............c eee eee A HRSA Gee iti, 60 where to be made.......... ais te Binh ieee woke seeeees iii, 60, 61 terms of .......... Qua adewen ae eae: ee was ese Seas seve TL, 61 not within statute of frauds ............cccceeeeeee sateen ML, 61 stay of, only granted by court..............006. enstuncnaves iii, 62 OW WHAT TOLICE wc .cn08 wikedien nadine cere etharne Hew are eaneres iii, 123 report of, what to contain ...........cceceeeeeecectececs iii, 62, 63 exceptions may be filed to.... 0.0... eee ee eee eee eee iii, 64 how confirmed .........-- eee ee cece cece eene ete oe iii, 64 wvhenusale Setiasld eis ii.s:013. ace. eva oieis aaa e nonsiaein eee eu iii, 64 resale when had..........cccceccccucrccscccccces arauarse chav iii, 123, 64 when for inadequacy ............ sce e cere ee eee ees iii, 65 when for fraud, accident or mistake............ stains iii, 65 for improper conduct at the sale............ 2. eee eee iii, 66 application for, by whom made...............-eeeeee iii, 66 WH MACE dss 5 ¥0-64:54 24.4 nea ames e eres wanda pis iii, 66 purchaser, who may D€....... eee eee eee eee e eee e eres iii, 62 what title may be insisted upon..............2 cece eee lii, 67, 68 may be compelled to perform contract........... gears Aly 67 when will be relieved from purchase................- iii, 68 entitled to possession ........-. cc cece cece eee e cence iii, 70 when becomes entitled to rents and profits............ iii, 71 purchase money how secured... ......+..eeceeeeeeeee iii, 71 costs how to be awarded .......-... cece cee eee eee eee iii, 7A proceeds how to be distributed ........... 0.0.2. yeee ee eee iii, 73 to be ordered by the Court........ cece eects iii, 73 may direct investment of infant's POPUOD oi..:54. 032 bene iii, 75 must direct investment of share of unknown defendant iii, U5 when share to be paid to unknown heirs ............. iii, 75 taxes, assessments and water rates to be paid.......... iii, 79 when security to refund required..................-. iii, 84 how to: be P1V6N. voce dere ccae ee ceniontawte toda ss iii, 84 how directed on foreclosure ......... 0... c cee ee eee ee eee iii, 116 taxes and assessments, how provided for on............... iii, 116 when subsequent sale may be ordered in foreclosure ...... iii, 118 how and by whom to be made ........... 0... ccc eee eee iii, 120 Guties of PevereciOtie 2.s2i6.c.0-444 44 dcnteonoaanmsnueeaesvaneon’ 111,120, 121 cannot be delegated .......... cc cece ee cece essaeeeee iii, 121 order of sale by may be directed in ejectment......... iii, 116 614 INDEX. SALE—(Continued): VOL. PAGE order of, if not directed......... Miaied we REE ES BARS ili, 121 general rule, where order of not directed............+ iii, 122 proceedings where purchaser refuses to complete.......... iii, 1238 liability of in such cases ...........6.. esa eddnseese Ul; 123 conveyance on, see CONVEYANCE. referee’s report of..... ee sees sacavaaaeese UL, 125 moneys arising on, how disposed of........ PrsGucevasGacesen Ml, 125 in action to foreclose lien on chattel........ Sve eyateyosenatevadeietee MAM 139 SATISFACTION: of part of plaintiff’s claim......... sedis staealas daieassa: ay 623 MEM OT dered eka tiiwealyegie aw leacs oss oe eeipenrnnaroeawenes i; 623 as to what causes of action............. cece eeeeee isle oe i; 623 where application for to be made........ Jaane ay 625 what judgment entered......... dveseasis sad Berets wees 1 625 of judgment............. iheees ha eaes 65.5 Shia epbtbsa Stecae sees. 11,585, 586 SAVINGS BANK: interpleader in action against.............ceeeeceeeseeeee A, 238 SCHOOL DISTRICT: when trustee of, may sue or be sued.........sceeeeeeeeeee Uy 117 SEAL: of courts ..........06 aRageres cate ces salenueesuaiee ly "13 SEALED INSTRUMENT: action on when barred........-...2.00+ dis Swen wisitdemeidenye Jy 70 SECURITY FOR COSTS: when a matter of right to defendant ..............-00--0- di, 484 who may be required to give.......... Sediee was cwenes wees 11,484, 485 what is non-residence ......... 22. cece eee eee Sale ecient . i, 436 in what actions may be required................... tines thas ii, 436 foreign government may be compelled to give............. ii, 437 foreign corporation, when required to give......... cores .. 11,484, 487 infant, when required to give...........ceeeceee cere ceees 11,434, 487 need not give when authorized to sue as poor person... ii, 438 right of defendant to require, how waived................ ii, 438 in LAXPAVer’s ACHON ccc scx teks ens 4 vomMDieS ee eANessese ii, 439 when discretionary with court to require .....-.....eeeeee ii, 439 grounds upon which discretion exercised.......+++++.+.+- 11,489, 440 application for order for, when to be made............0++- ii, 440 when right lost by delay ........... eee eee eteeeteeteees ii, 440 when application may be made ex parte.....+++erers rete ii, 442 on what papers application made ......--.seeeererettttt ii, 443 order, what to contain 6... cee eee eee ee eee etnenes ql, 443 undertaking upon, how to be executed .......+-2. seeteee ii, 444 fOUMOL sek saws eekidn ea eee ida wane nianoeies tee ii, 445 what to COritaite cs: a vcaeaadane ae dnaaiesasiean tee ii, 444 exception to sureties... 0... cece cece cece ee cenc cence ii, 446 additional security, when may be required. ............... deposit upon, when given instead of undertaking 11,445, 446 447 447 INDEX. 615 SECURITY FOR COSTS—(Continued): VOL. PAGE how undertaking enforced ...........ccccececucveeceeees ii, 448 effect Of TallWRE 10 GIVE. cccusessnew unre s ne see sade aanese ii, 448 liability of attorney where security not given ............. ii, 448 how liability extinguished.............. 000. ce eee eee di, 449 Ow enforced) ss. wauiweetied otek see eu sds oeaeeamehoe ii, 449 in special proceedings ......... 0... ccc ee cece ese ceeeees ii 450 SECURITY ON APPEAL: See APPEAL, COURT OF APPEALS, GENERAL TERM, SUR- ROGATE’S COURT AND JUSTICE OF THE PEACE, SEPARATE TRIAL: between plaintiff and one of several defendants......... .. i, 195 SEPARATION: action for, see MATRIMONIAL ACTION. SEQUESTRATION: of defendant’s property to pay alimony, see MaTRIMo~ NIAL ACTIONS. SERVICE: of papers cannot be made on Sunday ............eseeeeee i, 4 Of Process bY Sheth... cc sis wens semenaaiaaney oe eteaeee i, 18 on unknown defendant in partition ..................000 i, 131 of summons on guardian ad litem of absent infant defend- AD baw ke oe sew AeA APU nly a8 Se Sa Nee ee RRNA Eee BIE i; 141 of summons, see SUMMONS. of process to commence special proceedings, how made.... i, 160 of summons, voluntary general appearance, when equiva- Tent (Ola scteidco vise b.403 sana saet oie oe seas eee eee 4s i, 176 HOLICS- OF AMOMON 4.5. Laaiecdsccaaicescae eos TERETE HTS i, 202 Of COPY Of OPA... sacciens: weaseg ob Sale eee dA ed woes i, 215 WIEN: tOl OE ANA Csi racer wwe ch a oe SOL ob Sie Sey Aevetevesgis aisle’ i 215 On Whom to DE MAME. cscs seca ee aes elannee eewease i 220 when may be made on clerK...... 00.0. ec ee creer cece eee i, 220 personal, how made, on party or attorney ..........0.+6- 1,221, 222 by mail, how made on party or attorney...........eee eee 1,221, 222 proof of, see PRooF oF SERVICE. of paper, personal, must be eight days..... fa ats Green eeeae i, 225 by mail, sixteen days ...........sccccecnccaveseucees i; 226 time for service, how computed. .........ee cess eee eee i, 226 when double time allowed......... cece cece tere e ences i, 227 how completed ois1.44 wdegnes vag cok FA vee PEG goa Ae i, 258 when complaint to be served .........cc cece ee ee er ee eeeee i, 345 of order of injunction, and papers on which granted...... i, 485 SESSION LAWS: when publication of, may be cited ..... cess eeeeeeenenee . i, 96 SET-OFF: WHat TEAS Seok Sis see's pera A ERG RA neer Wewele exes i, 358 distinguished from counter-clnim.........ss006 Hesedavics i, 858 SETTLEMENT: Oe ee ii, 518 616 INDEX. SETTLEMENT OF ISSUES: See ISsvuEs. SEVERANCE: VOL, PAGE of action, when part of claim admitted........1eeeeeee A 623 SHAM PLEADINGS: See ANSWER. SHERIFF: an Officer of the court........0.cccecceesee ee ceeneeeeees i, 16 powers and duties of .......... cee eee eee Gubivalemnavecenee . i, 16, 19 liable for acts of deputy........ 0... cece cece eee ee cece » 16 when not liable for acts of deputy.............4- ivduaecnss i, 17 deputy’s return conclusive UPON........eeeeeeee eee eer eee i, 16 not to practice as attorney....... eee cece cece ee ete teens i, 17 cannot purchase at execution sale..........eee ee cee eee i, 17 cannot execute precess in his own favor.........+-eeeeee i, 17 must give receipt for mandate. ......... cece cece eee e eens i, 18 how process to be executed Dy........... cece cece erences i, 18 return of execution of procesS..........ece. eee e eee eee 1; 18 how service made upon.......... ais strat ciate arse halbie arenes i, 19 LEES Ol cnnosiawaiaw a diliniche: WANA eae S han REGIA i, 20 limitation of action against........... cece eee ee eee eens i, 78, 75 when leave to sue bond of, necessary .........--+-08 Ree Ply 94 what must appear before granting to sue........-.+--0-0+ is 94 more than one order to leave to sue may be made......... i, 94 how summons served UPOD.........ese eee e eee er eee mee 153 certificate of service of summons by.............0+eeeeee- i, 160 what certificate must show........... 0 ccc ee eee eee Pavia i, 160 liability of, in arrest and bail on failure of sureties to JUSHEY cs acde eyed aoe bee es bes ash ar lws seed dean eS 1, 432 must execute warrant of attachment............-+ -seeeee 1; 526 may require indemnity on executing such warrant........ i, 527 See, also, ATTACHMENT. responsibility for sufficiency of sureties in undertaking to discharge attachment... 2.0.0.0... 002 cece eee cee i, 560 must regain possession of personal property after attach- TOUT onus (gia aSorcwadeeudet4a¥e- vawumwauaeer een aes i, 567 after judgment, may collect whatever attached ........... i, 567 when may sell property attached after levy...........-..- i, 567 to whom property given after warrant of attachment WECALC i 4 sate ctatyigece sate toga enamine eN AeA i, 568 to deliver books, etc., to defendant after attachment VAGCHEE ns oy carta, dye ares Pee tagi et AWES ky edi omens i, 568 to file return after attachment vacated...............0000 i, 569 amendment of certificates and deeds of............0000008 i, 645 duty of under writ of habeas corpus to testify...........-. ii, 83 inventory of :.ttached property evidence against him...... ii, 87 costs in action against for failure to return execution. ..... 11,461, 462 FEES Obs nianiascn dh Sea io a8 nesehee PSI A Rat S5 VRS Se aC di; 545 fees for serving papers..... sess sce wwe eee ete eee eeees ii, 552 fees for levying warrant of aitachient. SkGRGK OD EES ERM ii,558, 555 fees for copy of papers served. ........ee ee eee eres eeee 5, al, 553 INDEX. 617 SHERIFF—(Continued): VOL. PAGE fees for notifying jurors. ..........ec008 eessscecccesees: ii, 553 LOES-ON; EXECUTION sos wwe y oa4s oe See aaa We ewe: es ii,554, 655 fees for returning mandate........... 0. cece cece eee wees ii, 555 when statutory fees to be allowed to.........ccnececaveces ii, 556 to satisfy judgment on payment of execution............. ii, 587 duty of, on writ of inquiry.............. GORE aiineuawa.s ii, 601 execution to be directed toO....... ccc cece er eer eee eeeees ii, 808 Cuty UPON, TECEIPU OL. ove icacewedeaecee serene os il, 810 instructions to upon execution... ....... 06 cece cece eee ii, 810 return Of execution DY ices ¢ssicievin sianiiviaisve deine weaver ede “ees ii, 812 cannot purchase on execution... ..... cece eee eee e eens ii, 819 how execution collected after death or disqualification of.. ii, 819 how to make levy on execution....... 6... ccc cece eee ees ii, 835 in action against, indemnitor may be substituted.......... 11,839, 840 notice of application, to whom given...........02.06- ii, 840 order upon application. ........... cece ceeeee eo sieaee ii, 840 duty on sale of real property............eee ee ao wiereis annserers ii, 852 conveyance by of real property on execution..........ee.- 11,870, 871 rights and duties of in replevin.........c.ceeseceseeseees iii, 183, 186 custody by, of property replevied .... ..........0ee eee iii, 186 duty of, on receiving property in supplementary pro- GOCdINGSevse wes ss sa sie Sao RN ARG awe Seen s See salek eure iii, 468 SHERIFF'S JURY: WHALE 1Sicaivta ces see weeacrae nee sce af Seeaiesa Sse ea SSSA ii,838, 839 SHORT CAUSE: : Calendar Olivos: auudnuee se cneeeeeeees Sravetaareiaa ec cidBiove. esSteieiae Aly 223 SIGNAL SERVICE: when observations of may be proved........ Siaiaintslepisiaisiete’s ii, 102 SLANDER: rule for pleading in........ cc. cece eee ees sjdisisielew: ‘selena i, 225 SPECIAL PROCEEDINGS: statute of limitations applies to...... cu. cceseeseeecoeees i, 88 service of process to commence, how made........-...065 i, 160 papers in, where filed.......... Jo ccc cece neceecescceans i, 224 when reference may be ordered in...........ceeeeer eee. ii, 349 S€CUTrILY LOT GOSS. OD. sesso acids dawcecds sdace eee cow ees ii, 450 COStS- OM Appeal Mikey. x sis arshavdvoarsaniSibveie see rb-t-4 6s Sw voted ii, 499 appeal TPOM). OTGEL Why. ess.s a sie aiiginsinsaie aie saris ole siaig ee eee ii, 736 Ol Appeal 1O SAME COUT vc sve dicwie sige sae oes eaigewenee te ii, 739 SPECIAL TERM: to be held in place designated by statute...........eeeee- i 7 may be adjourned to chambers..... ...-..eeeeeeseeeeees i, 7 actions triable in, when triable at chambers......eee.s.ee- i, q of superior city court, when held by one judge........... i, 8 may vacate order made by judge, on notice............06- i, 216 when motion for new trial to be made at.......ee066 .. ii, 400 SPECIAL VERDICT: 78 See VERDICT, SPECIAL. 618 INDEX. SPECIFIC PERFORMANCE: VOL. action for, when barred. .......sceeecceccececcvcesetocs STATE: when proper party defendant............e0ee0- qn oe tore: STATE OFFICER: injunction against, when granted at general term.......... STATE PRISON: superintendent of, how named in action .............008% STATE WRIT: in whose name to be issued............-. 0+ ee daltoweiterd STATUTE: where no provision made by, what practice controls...... 5 private, how alleged in pleading........ ISG ela Sete earns proof of from newspaper, when may be made........ Sante printed, presumptively correct................4.. aera eaiesis republication of, see Session Laws. of another state or foreign country, how proved .......++. STATUTE OF LIMITATIONS: See LIMITATION OF ACTION. STATUTE LIABILITY: when barred in six years............ é. setegies oliteie eke ears STAY OF PROCEEDINGS: by whom granted .............e scene s4)s ga serene ae wana judge out of court can only grant for twenty days........ practice, when longer stay required..................-.0- in first judicial district, when stay granted after notice of when granted on motion to change place of trial.......... effect Of: .xeaveeisiaePieeeae wee @ ROA eRe Seat ees when deemed vacated on decision............. cece ee eee ee for non-payment of costs of motion .......--.........005 offer of compromise, Operates AS....... cece eee eee ee eee FO COMMISSION. si0.issasedse casin’s: 1h MST ART ON Ra eee Lo o5 on motion to change place of trial............ cece eee eee to prevent multiplicity of suits ............... eee eee eee where several actions pending for same cause............. in one action to abide event of another.................248 after adjudication of bankruptcy ...............-.4.. Ree after discharge in bankruptcy.............46 PE Daa ateciapseng when necessary, to prevent injustice ................ cee effect of permanent...........+-..- eee Gialacete dea deuwln eae drdex for wppealablescaciccis cso ceaie wes naale Homa cece ees until costs of former action paid... ..... eee eee eee eee discretionary in such Cases.........6 66. c cece cece eee not granted until adjustment of costs ................ when must be granted by coutt.........-.. 0. eee eee eee ee motinn Tor, how WIAe:. avsnccnananerg saws ees hegeence OR, NUOLIGN TO" Pay COSIS mage anse mii omnomiceonamase via ce esharte oye 3 ALE VErUiChncatangrnwsiaranasin Anka were eae ga ee § i, i, ii, PAGE 71 117 480 118 116 252 96 96 108 val 204 204 205 205 205 205 214 216 629 45 185 177 177 178 179 179 180 181 181 181 184 184 184 185 237 327 INDEX. 619 STAY OF PROCEEDINGS—(Continued): VOL. PAGE on appeal from inferior court to general term, how applied for, ii, 728 on appeal from surrogate’s COUrt..... ce cece epee eee neces ii,'754, 755 STENOGRAPHER: TOES Of st sras ys izigne Ghrpenwaluiciemeg nae aia a 5 beh coe eTeare ne Aiolac as ii, 557 who lisblefote ws e....... ae Satis .. iii, 478 order appointing receiver . .........006- ieweuwiagse AH, 478 form and contentS......... ese eee eee sehen iii, 478 is a chamber order ...........e cee e cess eens oe iii, 478 must be signed by judge ............seeeeeeeeeee ili, 478 debtor may be restrained by ....... wits Wide eunal iii, 478, 479 presumed regular until annulled................. iii, 479 filing and recording of... 11.6... eee eee sarees iii, 479 book kept for that purpose .... ......--..5- iii, 479 liability of clerk for failure to record..........+.- iii, 480 filing necessary to vesting title................... iii, 480 filing where debtor resides in another county ..... iii, 480 security to be given by receiver.........-.6..0 ceeeeee iii, 480 two sureties required ....... 2.20.05 cece eee eens iii, 480 receiver’s title not complete until rand FIED sins seccsiecae iii, 481 new security not required on extending receivership... iti, 481 what is sufficient bond..... 1... ...0.. eee cee eee eee iii, 481 what property vests in receiver.............-.66. jii, 481, 482, 483 in case of mortgaged property.......... ..26 see ili, 483 where property in possession of third person...... iii, 483 where real estate outside of the state ............. ili, 488 judgment owing to judgment-debtor............. iii, 483 exempt Property ... 6. eee reece cere ee ev eee peeees iii, 488, 484 630 INDEX. SUPPLEMENTARY PROCEEDINGS—(Continued): VOL. PAGE whom receiver represents .............- siomie sewidsacls iii, 484 may bring action to set aside fraudulent assignment... iii, 484 may bring same actions as debtor could have DPOUBD Ga: ncckwan ideo cee warnnna aurea «laws iii, 484, 485 may employ attorney of judgment-creditor ........... iii, 485 may besubstituted as plaintiff in action begun by debtor, iii, 485 must obtain leave to SUC ...... eee eee eee cisternae ALT 486 must show valid appointment ............. sted Dawes Ally 486 when title of extends back by relation................ iii, 486 to what time relation extends.......... oi sieieveeisve-v tiie «dil, 487 extending receivership ...........ccccccccccccceccecs iii, 487 to whom notice of such extending given.......... iii, 488 control of court over receiver...........0s8 Sxise veweecdll, 488 court to fix compensation of........... SUPREME COURT: ivesecveecece Hi, 489 general terms when held........ iidinbsicse bebe ontaesie “Ty 5 appointment of terms.............. ie techipsraers sateveed tee vie Ay 6 extraordinary terMS ....... ccc ccc e cece ees rerre fein. = dy 6 when judges of other courts may bold terms.............. i, 6 Governor may designate justices to hold terms of........ i, v special terms of, to be held in places designated by statute. i, q may be adjourned to chambers.............ceeeeeees i, q county clerk is clerk of..........-. 0 eee es ison weeeee Jy 13 power to suspend or remove attorneys........seeeeeees cow 1; 22 original creation of..............66. screeuRtiog Rs eactais:. wie 39 how now constituted.............. SSIES waters Bieea Riese i, 39 general terms, how constituted......... scssseeseceeeeee A, 39 powers of justices Of...........eeeeee eee iaaieetnaeeones. Fy 40 has general jurisdiction in law and equity... ....... eadiven “Ey 40 given by the constitution....... 0 Jo... cece ee ee eee may Wy 40 extent Of ........... cece eee eee aiid. Seovavmonsvens MobiceGeeees 21; 40 in equity, what it includes.............005 ceeeeeees i, 41 in special cases.......---.++. Soieisle a liesasiteomiosieratiaiegs'® i, 41 when it may remove to itself, actions from other courts.... i, 42 for what equity business, it is always open............... i, 42 justices of, what they may do out of court... ...... eee li 57 may change place of trial in action brought in local court. ii, 125 may change place of trial brought in superior city court.. ii, 126 may change place of trial brought in city court of New WOT yi iwsg sa dee ack gad bc toate wera ROR SMON SERS mea - di, 128 may change place of trial brought in county court..... sea cal, 129 when action brought in, may be removed to superior city COUTE.. cece. sence aaah gueratdlla: ivje, seigieieew-e atone 0, BAIS Seis ii, 130 SURETY : Off ANNea) yiscs eases chico tees sewles teats Lena edenahies wee. Ui, 662 SURPLUS MONEYS: on foreclosure, how disposed Of... .....ceseeeeeeeeeee sows JE, 125 to he paid into court =... ..... sane sas say steaee’s soe TM, 128 will be controlled by court............ wage es de syeeeeasd iii, 128 INDEX. 631 SURPLUS MONEYS—(Continued): VOL. PAGE to whom paid after three months.............. aistelvataive ne MANS 129 claim for, how and by whom to be filed........... sense seta Su, 129 reference to ascertain rights to..... Wea pigia drelera os Cease ewees iii, 129 MOHON TOPs ses des vee waco eacteecene s ws veers sagas Aly 129 to whom notice of given... 22.0... eee e eee ee eee eee iii, 180, 181 is a special proceeding..............008 cee eece ewes . li, 180 when may be had......... cess eee e eee e eee Sseeceeucs lly 1380 In WHat, COUT: ccecedas uta Noes oF beeen SGes Meek iii, 130 proceedings before referee on......... Made elas ee eae .. iii, 181 who may appear before referee........eceeeeees woes iii, 182 powers of referee ON... .... 2 cece ee ence eee eh pebwrarnenee HL, 132 report of referee on, what to contain........... seve, Uy 1383 power of court, on motion to confirm.............+.. iii, 183 * SURPRISE: new trial for............. Bt eee View Vea TES 4 Chae: SeReRS: AL, 407 on what ground motion made..........ssseeeeeesceesees li, 408, 410 SURROGATE: leave to sue official bond of....... css ded ssa‘ aie eleiais- sides eiescewer’ ls 95 when may grant commission....... ...ceeeseeeee eee ewes. AL 39 cannot compel security for costs.............0+6- dsesenwe Ul, 436 SURROGATE’S COURT: limitation of action on judgments............. iS ipaenvenenintades i, 69 who may appeal from decree or order of....... winedee aiews ii, 748 facts authorizing appeal, how to be shown........... inaates dy 748 who are persons “‘ interested” in decree.................. ii, 749 what decree or order of may be appealed.......... es ii, 749 intermediate order, what may be reviewed on appeal from. ii, 750, '759 appeal from to be taken to supreme court..... sae aderdieaese ii, 750 notice of appeal what to contain.......... be iaceeeasea e's ii, 750 service of nOolice....... 6... eee ee eee A oneal tas notte ii, 51 how person not party may be brought in on appeal...'..... ii, "51 notice must be served on all persons interested in decree... ii, 752 security to perfect appeal from.......... 2.2, Sb Abele omer ii, 158 when required to stay proceedings ................... it, "54 proceedings when stayed by perfected appeal....., eee ily 755 undertaking on appeal from decree of.................... ii, 755, 756 amount Ofsiceeds se0 Shi de seaweed ammeas oauaeren ii, 756 when issue of letters of administration not stayed by ap- DOA 5 > spavntesartane aces a Advan, “eae gis aides Sie Reese id xd ii, 157 authority of administrator pending appeal................. ii, W57 case submitted on appeal.................008 sos ii, 758 what questions may be raised on appeal from......... ... ii, 758 law or fact may be reviewed on appeal from.. ...... eae Why 159 appellate court may decide questions of fact ...., sesessss Hi, 759 decision of surrogate must have been filed................ ii, 759 when new evidence may be heard by appellate court...... ii, 759, 760 how appeal heard ...... 6.0... cee laces cs cueeeeecseces ii, 760 judgm>nt or order upon appeal from............ 0.0 c cee ii, 760 632 INDEX. SURROGATE’S COURT—(Continued): VOL. PAGE when trial by jury must be ordered on reversal of probate Of Willeiaxciccceucaceaws tah Dea deae es Sey aprtieshe ws ales ii, 761 not ordered where reversul is on questions of law only ..... ii, 761 proper order in such cases.......-- e+e eer eee ee eee eee es ii, 7162 when leave granted to issue execution....... .++seeeeeeee ii, 795,797 Sce EXECUTION. has no jurisdiction to admeasure dower............... «. iii, 89 SURVEY: when ordered in ejectment...........-.. Sia quanbadt ayaa aa iii, 16 in action relating to real property........ Sleesiisieudce ac hea Ally 16 See EJECTMENT. fees for making survey in partition............ ee ee fase iii, 2 may be ordered in action to admeasure dower...........++ iii, 94 T TALESMEN: TOW: PLOCULEM wicice staid neva yeier ier wic wl eesleso%e'9 0.0 46 Waceele eee ot ii, 250 TAXES: assessment of, will not be restrained by injunction........ i, 471 how collected of non-resident by supplementary proceed- ING hewier we scdmaveanestes meer eee eee eb ee eccs sek oe es iii,404, 405 who may bring such proceeding.... ...... ceeseeeee iii,404, 405 costs in such proceeding ........ sitemetaaante wabradanecs. iii, 405 TAXATION OF COSTS: to be by clerk... ...... cc cee ee eee alate bieibiereterateeaieioe eee TM, 534 when to be by judge......... Siena vata acciee Be Ma insect ii, 534 when to be inserted in judgment .....,.......... bean oe 11,584, 585 duty of clerk upon.......... 0. cece cee eee ee Lanebineivians ii, 585 only items allowed by statute to be taxed on.............. ii, 5385 TOUICS. Chis tatetinn sce qsuassincoe Rageie seaside siete dasa ea sin als weceeels ii, 536 when may be postponed..... .... ccc ce cece cece wenn eee ii, 536 affidavit of disbursements........ ites Gere Cereb 3S ee eee SE eee ii, 537 not to be without affidavit.......... aisieulie se dae aiwee ii, 537 to be served with notice of taxation......... sacle sis ii, 538 See DisBURSEMENTS. objections to, when taken.........-...seeeeeee eee oe wees I 538 how to bé Stated... ccna chad ieee eas bag usu ies sveeccae ii, 5388 when party not concluded by failure to object ........ ii, 538 re-taxation by defendant, when costs taxed without notice . ii, 539 when court will direct, in its discretion............... ii, 539 to be reviewed by motion for re-taxation.............0.e66 ii, 540 MOMOW LOM Ne ssc: nwa vad A425 UhES Ss? Goagrateedenmedceds ii, 540 when order to review original taxation ............... li, 540 proper remedy for error in taxation.... .. 0... .. eee eee eee ii, 540 where motion for to be made .. 2.0... eee cece eee eee ii, 540 what papers'to be used. On. ...scviseeaeveecuevereacenees 11,540, 541 what objections to he taken On... .. cece eee ee eee cee ii. 541 right to costs cannot he raised UPON. ..... Lee cee eee ee ees ii, 541 INDEX. 633 TAXATION OF COSTS—(Continued): VOL. PAGE what order may be made upon .......... dissatavikeceebaas . 11,640, 541 when new taxation will be directed ...........0.ceceeeees ii,540, 541 TAXPAYER: may sue to prevent waste............ 0. cece eeeeeee sesa I 118 when injunction will be grant:d in action by...........46 i, 467 action by to prevent waste................ 0008 eae «ae eae iii, 253 who may maintain such action ...... 0.0.0... cece e eee eee iii,258, 254 for what may be maintained.............. iii, 354, 355, 358, 359, 360 what wrongs may be redressed by .........esceeeeeeerees iii, 356 what waste may be prevented............0. cece ee ee ee ees iii,356, 357 what are public funds...... stn ow dadtye a us “Oy hosp oavermeaans iii, 857 what included in words ‘‘ property, funds or estate,” ...... iii, 358 when taxpayer will not be permitted to suc...........0.0 iii, 359 security to be given by plaintiff.................05 eyalsieeisve ALL, 361 against whom such action may be maintained............. iii,356, 362 proceedings. in the action. -.: 242.2 :is4ss cease eeeewsuews iii, 363 when injunction may be issued. ............- Hesuewsme x cdl; 363 judgment, how to be entered............ 4 eigen PEWS acess iii, 364 what relief may be given by judgment.................. « iii, 364 when individual judgment may be entered against defend- PINE assva Grutcorc tracestaseine cles WO eeu isd phe dar paisnacttanee. Soraaeies siee 8 iii, 364 TENANT: when payment or redemption by in ejectment for rent in ARLES 41s hare hanining sass: alee deh se wl as Sess Seerertiewaiine. Ms 24 TENANT IN COMMON: complaint in ejectment against......... divans. weesees. AM 12 may bring partition. ............ 2. cece svlewurseerentss iii, 27 action by, for waste against co-tenant...... ...ceeeeeeeeee Hi,153, 156 when may maintain replevin........... se isarecwicwssace U,168, 169 TENDER: in what cases may be made............. Hedinae gate ees varie Cue 616 how tor bes Madea oie eo ccnsias sia eaaleaiea meme geass i, 617 kind of money in which made...........+64 ates 'aleranctatatens i, 617 offer of money, when waived ..... ...seceeecececeeeeees i, 617 to Whom ‘Made@svcsivawws ce veer esas ae sea tnatios ermaeenes 6 i, 618 money must be paid into court.......... cece ee eee wena i, 618 CMOCKOL so.c digs antecdcaaa sae Sten aens se aea's take eee i, 619 as admission of right of plaintiff to amount........... i, 619 BASEL ONCOS ES! 5,4 oso Zee yo Bihees nee T”oe sa gesh gus ude: So eau aend acauelapar austen 1,619, 620 when to be deducted from recovery.......-.eeeeeee seeee i, 619 in action for foreclosure .......... 0 cee cece ee cece eer eee iii, 119 efhect Of satin goean se Sow Aiea BAAN Mla US eee eee iii, 120 TERMINATING ACTION WITHOUT TRIAL: See DISCONTINUANCE. TESTIMONY: perpetuation of, when matter of right........ Seneteeaae ewes 3 party may perpetuate his oWN.......-...eeeee eee seeenea dh 3 80 634 INDEX. TIME: VOL. of limitation of action accrued between death and granting OF TROP cose eves 66449.04094 24 eP oe epee Ree ao vawe® i, how computed where plaintiff dies before expiration of Timi tation: oaen wseriewesiowanee ae hens tainted ete pies scgssues Je dhs when reversal of judgment extends, to bring action. ..... i, to bring action, when extended by stay of proceedings.... i, when extended by submission to arbitration........ adaaas’ Ay how computed under statute of limitations. ............- i, See, also, LIMITATION oF ACTION. within which infant defendant may answer .............. i, for doing any act, how computed.......... tie ssiavessea Ay extension, see EXTENSION OF TIME. how alleged in pleadings............. ccc eceeeee siecneteedse by within which motion for provisional remedy to be decided. i, when offer of compromise to be accepted ...... die-ctoatheeaeer tay to apply for relief against mistakes .............. spadisinsies Cal for motion to vacate judgment for irregularity ........ .. i, TITLE: : to real property, presumption as to........... ag hegiisvere — dy to real estate may be tried in partition.............e00.++6 iii, TORT: arrest in action for, see ARREST AND Batu. when restrained by injunction............ ‘sienna costs of plaintiff in action for............... sseswaawenins Ay judgment cannot be confessed for...... Ace Wwewaeeav ese Lp TOWN: actions by, when brought in name of.........ceeeeeeeeee Vy TOWN CLERK: copies of papers in office of, when evidence............... li, TOWN MEETING courts not open on day Of........cceceecscercceveecevene dy TOWN OFFICERS: when may sue, or be sued. .......... iseuv siete scceass, 4, TRADEMARKS: when violation of, will be restrained..... wae Gestssassesa Ty TREASON: who plaintiffs in action upon forfeiture for........ Peewee tl, TRESPASS: when restrained by injunction......... One ree rece i, TRESPASSER: action for timber cut by... ... .... Sieve Gaewasn” aabgieae ally TRIAL: ; when of one action, stayed to abide event of another ..... i, after substitution, objection that action does not survive may be taken at....-.. eee c seen eee beeen eee eneee i action does not abate after decision or verdict............. i decis'on upon, void, if ma‘e after death of party ......... 1, PAGE 80 80 81 81 81 83 180 226 249 614 627 648 653 64 30, 41 475 628 118 98 117 472 116 474 162 236 665 675 676 INDEX. 635 TRIAL—(Continued): VOL. PAGB when discovery granted to enable party to prepare for.... i, 683 See, also, DiscovERY oF BooKs AND Papers. place of, see PLACE oF TRIAL. of issues of law..... ......... 5 awe wae eed ales need ii, 187 of issues of fact.... ... detected Rae ParaNS esa wea. teeer ade ii, 187 mode of, a substantial right ............... seeeese. Li, 187, 188, 190 mode of, determined by pleadings.......... a Rosas avers aveiaeils ii, 189 mode of, where equitable defenses... ............. srerstaiecaie ii, 189 mode of, when legal and equitable causes joined....... .. ii, 189 of issue of fact by the court. ..... 2... cc. k cee cee ii, 190 a substantial right.... .......... wd dels webhay ae henvere ii, 190 what actions triable by the court ... ........... see eeee ii, 191 mode where counterclaim interposed...............000. os. Al; 191 by jury in such cases, how obtained by defendant .... ii, 192 right to particular mode of, how waived ...........+eee05 ii, 192 Of issues, OTMET Of. Loc csee cc cee cee n eee eaineesescenns die: “Ul 194 separate, between plaintiff and one of several defendants .._ ii, 195 of issues remaining after trial of issues settled by jury .... ii, 196 preparation for, see PREPARATION FOR TRIAL. pleadings fur court on, by whom furnished .............+ ii, notice of, see NoTICE oF TRIAL. when postponement should be applied for.......... Specie ii, 215 postponement of, see PosrPONEMENT oF TRIAL. who may bring OD ....... eee ee eee eee cece renee iscee Hy 221 when party noticing must pay costs, if not moved..... waxes, Oly 221 reserving cause for ..........2.-- ee ee ee econo dewawwae “Ly 222 See INQUEST. See DEFAULT. new, see New TRIAL. fees on, of issues of law, or fact............ wipe gener geese ii, 506 of issues in ejectment...... 2... cece weer ee eees hieente ns ili, 17 AN, PATELION: 352425 54 de eee era Gas Keeeme Eee iii, 43 in action for admeasurement of dower........... .... ili, 94 in action to foreclose mortgage .......0 .........6 65 iii, 114 in action to foreclose lien on mortgage............... iii, 139 in action to determine conflicting claim to real PLO PET Leone iaae At ch Va oowwueeewiees § sireencee bab, 147 in action for waste............ecceecceee i ates g 70 so laste wie iii, 152 in action for nuisance. ...... sie we wie ew igeewsees iii, 160 in action for replevin . .............2..05 Bsa eneaNeie iii, 177 by jury in action to annul marriage................ 2... iii, 209 Inaction fOr CIVOVCO x. 6 seed cane apie nd co araee ces sonne iii, 222 matter of right in action for separation............... iii, 236 of action to annul corporation........ 00.66 ceceee eee eee iii, 280 of action to estabiish or impeach will....................- iii, 317 of action against usurper of office or franchise............ iii, 392 TRIAL BY JURY: how jury draws ssc0ee ses ss teases eee eweraceweve yeas ii, 250 talesman, how procured.......... cess cece cece ee enews eee ii, 252 who to summon, wheu sheriff a party......... SPs weed ii, 254 636 INDEX. TRIAL BY JURY—(Continued): VOL. PAGE challenge on, either party may interpose....... eRe es ii, 254 kinds of challenge...... 0 ..-.. eee eee ee duce aimee ii, 254 COAT AV WAG ASi es os esas wie sedan cress avecap ate waa nate ii, 255 when must be taken..........0ceceeeeseeaes eawdsiae ii, 255 what cause of challenge to .........- cece cone eee ii, 255 challenge to the polls, what is............ 0 ceeee eee ii, 256 KID GStOL og ks ca catecaeenta eae nee ig eNaeyetaleravahans ii, 254 challenge for principal cause, grounds of............. ii, 256 that jury is related to party ...... ccc eee eee eee eee ii, 257 opinion, how far ground of challenge... ........ ... ii, 258 challenge for favor, what is............... ou 8isieiepigredeners Hj 258 STOUNASOL.. accuse Nes geeg ea gees eese'ests sara aie . li, 259 by whom tried................0008 aivartcieinmarelensy 7S « Hh 260 juror may be examined upon.............. Sees os ii, 260 peremptory challenge, what is............ sieltnsinardaree erates ii, 260 each party may have two.......sccsececseeceecceces ii, 260 waiver of challenge. .............ceceeeee cee witteemweate: Ll, 260 motion for judgment on pleadings, when made........... ii, 261 ground of such motion...............00c0 00s sie naiwaisue ii, 261 to compel party to elect, motion for.......... Lemetiatnee ace ii, 262 right to open and close............000 VEGA icereldsuaigeresseace 263 beginning of the trial..... eG ORES ERS he seas See Remescea” Aly 265 opening by the plaintiff............ .... eeeweeneeasioarece Sg 265 dismissal of complaint on opening..... Haydieu aca erorns eves dl, 266 party opening must exhaust evidence.........eee-eeeseees ii, 266 examination of witnesses on, see WITNESS. how right to trial by jury waived.......... wi caieaae oiteet as 192 by failure to demand ................ Sis BesharerarieAisr nee ii, 193 by joinder of legal and equitable actions...... isles wise ii, 193 when ordered in equity case....... 6... cece ee eee ee eee ii, 198 right to, not lost though issues not settled ..............4- ii, 197 motion for nonsuit, when made. ............ ee eeeeeee sie A, 266 cross-examination of witness on.... ........... veeee Li, 267,269, 278 purpose of cross-examination......... 6. cece eee ence ewes ii, 274 cross-examination of witnesses on, see WITNESS. right to, absolute. ...cceeesccceecsacess ee ee ii, 275 how far in discretion of court........... gadicand- a siseetecenens ii, 275 party may, as to whole case.......+....- BAwa:F eeaianeneess ii, 276 proof of contradictory statements upon..............- ii, 276 to be shown writing on which examined............- ii, 276 answers on cross-examination as to collateral matters CONCIISIVE sees Be ecees Elec ge tee e ee Sees ee Fe elw Rs ii, “276 hypothetical questions to experts on..... Peis ewe ERS ii, 277 extent of, as to hostile witness............e0000 speieess SAM 277 what a witness may refuse to answer......... tives i, 278 re-direct examination of, see WITNESS. impeaching witnesses, see WITNESS. rebutting testimony... .... 0... 06.6 ce cece ee ee eee en ences ii, 267 reopening of case in discretion of court..........ee-eeeeee ii, 267, 269 burden of proof, on Whom li€S.......... eee e eee cece eeee: ii, 267 INDEX. 637 TRIAL BY JURY—(Continued): VOL. PAGE order of proof, how far discretionary ...........e.ceeeeee fi, 268 view of premises .........0. 00. c ccc cecee eee sisioie creeieatneue Aly 270 when leading questions allowed on direct Bisel 1 e Syren sieeppeatio ii, 272 number of witnesses, when limited .................0.-0. ii, 272 hypothetical questions to experts............0....6 000-2. ii, 273 how far examination may be limited DY COUT se ccicssins eaves li, 273 papers, proof or use of on trial, sce PAPERS. pleadings on, how far evidence...............cecce cece ii, 283 memorandum, how far may be used by witness to refresh TIC INOVY .aea Missach. veuavaintes nina neers tal aoe Rw wale & APOE SPARS occ ii, 2838 judge presiding at, cannot be called as witness............ ii, 285 juror may be sworn as witness............. ceeeeececeaes ii, 285 motion for verdict for non-joinder of parties.............. ii, 286 when complaint dismissed for..............eeceeeeee li, 286 nonsuit on, see Nonsurr. withdrawal of juror on, when allowed...........0....... ii, 288 terms of allowance ..............ccccceveccscccccece ii, 288 ordering verdict, see VERDICT. offers of evidence............. ...e0. Simerewee geese aos ii, 297 not usually permitted....... ......... ststals'ghess Srmatpae 4 Aly 297 construed with great strictness........ pele eons auNs ae ii, 297 party making, must show clearly propriety of........ ii, 298 objections on, what may be taken..............eccce eee ii, 298 when must be taken................ cece Bae a eas ii, 298 to competency of witness, when taken................ ii, 299 how made after testimony taken...............0.0005 ii, 299 general objection, what is............ ccc eee e eee cece eee ii, 299 eMech Ole. socnstathendadas seh nanuedduw anatase ese san ii, 299 what may be raised bDy.......... 0. ccc cece cence cues ii, 800 special objection, what points must be raised by .......... ii, 3800 incompctency, because of personal transaction............ ii, 300 objection by one, where two or more defendants.......... ii, 301 effect of overruling untenable objection.................. ii, 301 exceptions on, to what may be taken...............000005 it, 301 upon decision on challenge to juror...............2.. ii, 801 not taken to ruling on question of fact. . ........ .. ii, 301 if not taken, objection waived............. Sntiteeweewe ii, 302 OMCeiO fiw a nivan casey eae neepeeNee seaebareeaas aes ii, 302 not taken unless actually taken................00000 ii, 302 will not lie to exercise of discretion.. ......... e052. ii, 802 remedy where exception not allowed..............05+ ii, 303 motions to strike out testimony...... 1. ceeeseeeseeeeeee ii, 804 when they may be made............. ceeceececeuees a 303 granting usually discretionary.............seeeeeeees ii, 303 when party entitled to have granted...............05. ii, 304 summing up by counsel, absolute right of party........... ii, 804 time allowed in discretion of court................... ii, BN5 when several counsel allowed for different defendants. ... ii, 305 . privilege of counsel upon summing up........ .......00. ii, 304A books not allowed to be read by counsel on........... ii, 306 638 INDEX. TRIAL BY JURY—(Continued): VOL. PAGE when question ‘of fact arises............. Laxvare essen Oly 307 when questions to be decided by the court.............++- ii, 808 when specific questions of fact may be submitted.......... ii, 809 charge, court to decide what questions to be submitted to JULY ig ee eee wasn nce, Kaisha nn eeaniem nae Ee ETE Eas ii, 308 court not bound to, unless requested...... ...-e-eeee ii, 310 what to be submitted in....... 6... ce eee ee eee Bae ii, 310 how far opinion of judge may be stated on..... ....... ii, 310 rule of damages to be stated on... ......-eeeee eee eee ii, 311 whether effect of verdict on costs to be stated on...... ii, 811 when required to charge upon material questions...... ii, 312 instructions should be public ......... sees wialahaeererat sere “TS 812 requests to charge, when to be presented.............- ii, 312 how to be presented. ..........0e cece seee cee tewecees A 313 what to be presented ..........0. cece cee eeeeeees aie a 313 what requests may be refused........ sivsaaeoennssie Hy 313 when not error to refuse request......... sisi alee cinistatets ii, 314 exception to, when to be taken.,......... SERSiveLN Ewe ii, 314 manner Of Akins 2 e..cs cence teedia eae eMeRees ii, 3815 general exception to, when not good............. stew Hy 316 necessary to take advantage of error..... apseatalsiecasayriaieie ii, 316 consultation of jury... 2... cee eee ee eee eee iS avauane Giese i, 317 jury may return for further instructions.............. ii,” 317 what papers may be given to jury on...........06+ sage “dl, 317 further instructions must be given when asked........ ii. 318 what court may do to procure agreement of jury.......-.. Hi, 318 may discharge jury if unable to agree............ ceva cll, 319 effect of interference with jury...... (gia diaie geubiees ii, 319 effect of, see VERDICT. application for verdict... .......... ck Suanhttasrageee ate’ Sores ds 827 forstay of ProceeGiIN gS. seass% 6 seu due die eets es ae esa ii, 327 to enable party to review trial.... 0... ec. eee eee eee ii, 827 directing exceptions on, to be heard at general term....... ii, 328 when ordered on reversal of decree admitting will to pro- PatOnaccevioiaes4 besides “gteiberoeioaleane shew e ax wes eie ii, 761 TRIAL FEE: when payable............06. Ncabaditinainoaamenamesc tesa aly 14 TRIAL JUROR: qualification of............0..000% sdgeestingeenesaes yetiey Ty 239 aasessment not necessary......... iwawas Evaiglaeis Sanger aie oily 240 qualification of in New York city.......... won wsieleeeeet ii, 240 who is resident in New York city..... eee ies wats aac Al, 240 qualification of, in Kings county...... eT eee a ii, 240 who disqualified to be .........eeee eens actiegrareisiy Saracens ii, = 241 who exempt from service aS,......e.e scene wbreuae fags fi, 241 evidence of right to exemption... ....ccae cece cece eee eens ii, 242 in New York county ............ 6. Sioceigcarains A srasec ie aie Ly 244. Ii NSS COUNY ss. cc dave oc ee nd Cae se eee ie gate seievsaaie HL: 244 exemption not a disqualification. .. ...eeeeeeeeeee csGyeaay ots 245 INDEX. 639 TRIAL JUROR—(Continued): VOL. PAGE when ballot of, must be destroyed................ Sanaa ii, 245 when person returned as, must be excused............-005 ii, 245 TRIAL OF ISSUES OF FACT BY THE COURT: atrwhat term Na cic cc pacousmo eee cea giaes aus euaaad ii, 329 stipulation for, at other place than court house...... “Age athe ii, 829 - preliminary proceedings upon..... 00.0.0... eee e eee ee eee ee ii, 829 exceptions during triales-cieccceccasryaesewss) sew wears ‘ii, 330 should be begun and finished before the same judge....... ii, 380 account may be taken upon, without interlocutory judg- TMG Tiliega dct pins Sed ative y Cain ais a om ey lee amie torste ered ii, 331 evidence must be taken before COULt....... cc. e cece eee eee ii, 331 effect of, where taken by referee...........+65 Bdteavésevete ware ii, 331 requests of finding, when to be made............. seeeenes ii, 332 how made........+--.+-.++ pew atS Seabee eee e ee eeeeeee ii, 332 form of.......... Beseita aid Sikgeiees stase'g'e's. 3's Sines Riles iwsdan ii, 333 time to make, may be extended ........eceeeeeeeeeee ii, 333 when must be passed upon..... . 6 ceeseseeeeeeeees ii, 833 effect of failure to present...........000. cieareletoan's os ti, 334 decision must be in writing... ... be elas 6 ed silontewneevewe: Ly 335 FOTW Ol se 655 02S 5 a Aide eete AE SE Es Ope abe Sie x Waren atee oa ii, 835 by whom usually Grawn ...... cess eee e eee ee cence eeees ii, 336 when separate facts only should be found .............4.- ii, 336 when facts should be passed Upon.............ceeeeeeeeee ii, 336 exceptions to decision of, what can be taken.............. ii, 337 when exception taken to findings ...........ceeeeeeeeeees ii, 338 when to finding of fact .........e.eeececeeee cececeee di, 338 what question raised by... ....+.-eeee sted aie alae siete ii, 339 what may be taken to refusal to find..............6.. ii, 340 must be filed within ten dayS........ccceeeeeee cecceeee ii, 340 TRUSTEE: action against for debt of corporation, when barred ....... i, 76 counterclaim, in action by or against.............0eeeeeee A, 366 receiver in action against. ..........- cece eee e enone reine dy 580 of school district, costs in action against.................. ii, 477 costs in action by or against..... 62. fee ce eee eee eee ii, 478 when will be personally charged with costs........00ese0: ii, 479 may file notice of ownership Of.............ceceee eee eeee ii, 586 effectiol such NOtICE sn. <- cass sp arpaweieeiidabewesee ose ees ii, 586 cannot confess judgment............ cecccaccccccecceecs ii, 629 when may sue in ejectment.............ccceeeeceeeee cece iti, 9 of corporation, action against.............ccceceeceeeeers ili, 255 only suspended by final judgment ............0ee0005 iii, 256 to what corporations this rule applieS.........se.e0008 iii, 276 TRUSTEE OF EXPRESS TRUST: when may sue as plaintiff.............6 WWig Bra eiere Sadia esas i, 119 WIL! 1S bn. niweute ache oes oe 2 ce dave teary apcNolaeatd wwtieewats eietee> A 119 assignees fOr CTEMUON. wicca ceaaccwelsawea genes venees i, 119 assignee of life insurance policy................00085 i, 119 commission merchants...........0..00 00 ceeeceeees i, 120 640 INDEX. TRUSTEE OF EXPRESS TRUST—(Continued): vot. PAGE general agent of incorporated association..........+++ i 120 trustees in subscription paper...........cceeeeeceeee? i, 120 general guardian of infant..........eeeee86 Secenawee i, 120 Uz UNDERTAKING: ; attorney shall not be surety upon...........4- Soc Gatehisinbus i, 27, 231 in contempt proceedings, in whose name brought......... i, 116 oquisites Of sess. c20- ka seevtaeewd dee ese sos eels o-. i, 229, 231, 232 substantial compliance with statute sufficient....... eewnes. Ad; 233 wheu one surety sufficient........ Sileesai eg eab sense teases oem i, 229 by fidelity or surety company, when permitted sabes ew plareoe i, 229 when will be approved.............. ere ree sate Pods 230 approval of bond discretionary............. atest ia crs iatnartns i, 231 justification of sureties on, how made... ... BANA een ces i, 281 what proof sufficient on .......... 0... cece cece eee e eens -» 1,281, 232 where penalty is over five thousand dollars ...... ......+- i, 233 court must require proof...... 0... cece eee cee eee eee eee i, 281 court may appoint referee to take......... MRCS: See i; 2381 moust be approved......... cece ccc c cen c tees ee ccecceceere 1; 231 must be filed............ fe eee ape dkny Papal eee a geaosaunie ain ates el 1,225, 233 defective, may be amended........ 0... eee cece ee ee eee i, 233 action on, by whom and when brought....... daneeeannsas i, 234 OD ALTeStANd DA csc oga'y saute ane segs sie Minden aaienign ee S i, 416 on injunction to stay proceedings in action..............-- i, 489 to stay proceedings upon judgment... ..........+.-- i, 489 to stay proceedings in ejectment or dower...........- i, 490 on attachment must be given...........005 cee cee eee ee i, 524 on motion to discharge property from attachment........- i, 559 on attachment, when delivery of property to defendant -.. i, 568 by receiver of corporation......... 0. cee eee e eee cece eee ds 601 amendment-Ofes ccc sasudad vexeten evens sos wiper i, 641 on security for costs, see SECURITY FOR Costs. on appeal, see APPEAL. to prevent sale of real estate in action for specific perform- ANCCOE CONMTACE, 4 nee eSeeeak we seessse eRe maunsecs ii, 689 UNKNOWN DEFENDANT: See DEFENDANT. investment of share in partition...........+.eeeeeee eee iii, 75 costs against in partition ..........6+ seer eee ees Scaled aaa iii, 72 when share of, paid to known heirs..............+ee0---- iii, 1 USURPER OF OFFICE: action agaimst 6. 1 cece eee eee cece eee n eee e cena iii, 378 substitute for writ of Guo WATTANTO . 6... cece eee eee iii, 78 nature of writ of quo WATTNTO. 0. cee eee eee eee ili, 379 right to office cannot be determined in collateral proceed- TIMOR veesdheebess 8 Fe eREA Caw en ee bees econ gare nae iii, 8379 must be Adernniiel’ in action by people...... Sisien, eeere 111,379, 380 INDEX. 641 USURPER OF OFFICE—(Continued): VOL. PAGE when private action for salary may be brought,. ..... ... iii, 380 when attorney-general may bring action............ .... . iii, 381 at what time action may be brought against... ............. iii, 382 people necessary parties plaintiff................. ide dws or lly 382 against whom action may be brought............. seeeees. 11,381, 382 only to be brought in cases prescribed by statute .......... iii, 384 when brought to test validity of corporation ..... Soh npn iii, 384 may be brought to test right to act as director............. iii, 385 party claiming office may be joined as relator............ iii,386, 388 mandamus not granted to compel attorney-general to bring, iii, 387 only brought at discretion of attorney-general............. iii, 387 complaint in, what to allege.............. eee sieaisesers eo all 388 defendant must show by what right he holds....... seveees Li,889, 393 should set up facts showing right to hold...... ils auiereisin seers iii, 390 may be tried in any county................ So weatise ss e5e4 Il, 390 order of arrest in such action ........ PRS oisiesaeiaee Oo. e eed iii, 391 injunction, when may be issued ...........seeeeeeeeees .. iii, 391 trial, how to be had................- iyaiud pe aleve! erese oles iaia se ees eea Addl, 392 JUAS MOG scx. asiictaace, ssiaery cela aap eie winte ores Sis 8 se oggupeeendieaee Hy 393 must restrain defendant........... sisislate dais a -deip-ee ceva, al, 393 must oust defendant from office........06 seeeee eeee iii, 394 may award fine against defendant....... Width S46 ais saeewer HH, 394 how docketed and collected.......... aac OgIee: absitie wesw 1, 394 against corporation, how costs collected.............. iii, 894 when may award damages to relator..... . Seas eee iii, 394 effect of judgment of ouster........... Ssdieecmgeec lls 394 when relator may recover damages...... ait savers Wee theaweahaace Ele 395 how relator put in possession of office............... sees 111,395, 396 proceedings if defendant refuses to deliver books ......... iii, 396 COS tSicitates cree Sakis agate Gelea ee cae aae malas euaiee kwetes Ally 897 USURY: to recover back, when action barred.......cecsssseseeees A, 16 ! V. VARIANCE: what is material ..... .. siaevawieanid 6 cv ewewigiesesaaeae, A 7288 VENUE: See PLACE OF TRIAL. VERDICT: may be received on Sunday..............4- savaewtenewe 1, 470 qmendmentof s..aceisecssaie waveavews naMinnieseetaees, By 645 what defects cured by.......-...... aie aeawies Seuetaeapawe ly 656 action does not abate after ..-........ cee eee stateseticutaters i; 675 void if taken after death of party...........-- siisiaieig esatbieve's 1; 676 effect of Ordering ..... cece cece cece enero sen senenes ii, 293 when COUrt MAY OFAeLr... 6... ween ee ee eee ence oenes ii, 294 subject to opinion of court, when may direct............. ii, 294 when mistrial to direct ............ sie'eeieee ivgbiviseesees, Ly 295 81 642 INDEX. VERDICT—(Continued): VoL. PAGE on hearing at general term, when question raised....... a0 It, 296 ON, Specific QuesthON a scisse ss cow anaeeadeearcuteewea seo ii, 309 courtimay order sealed. cssiiscci dees ack dee epnendaesesienunens ii, 318 general, ‘What 18s deze cadcwheseaau nastaisd aacneaweweceein ii, 319 when jury may Tender... 35 Sead bas cee an oak @oee Ree ad ii, 319 when may be rendered against less than all defendants .... ii, 320 when several verdicts may be rendered ......-....0..00 ii, 320 when surplus does not Vitliate........ cece eee cece eee enaes ii, 320 special, what is .............. a Biaiatgie 6 earatwtavenea deed ane ii, 320 when jury may be required to find ................05 ii, 320 requirement discretionary with the court...... ...... ii, 321 WHAt: (0: CONGAID Le 321 motion for judgment on where made ..........0.000- ii, 606 what to be considered on hearing of.. ... ....-.-006 ii, 609 for what party may be ordered............0.eeeeeees ii, 610 in action of ejectment ... 22.00.0022. wee eee seveRaiees Hi, 321 for determination of claim to real property........... ii, 322 OF VPC NIN os ssincuste eieternds oracle dar 3 Astane a ches Saba Nie e ii, 323 must be delivered publicly ........ asst edes Hea eriedieseteie ash ie ii, 825 concurrence of twelve jurors necessary tO.........-+-26+- li, 325 when to receive.............0.. ues» SNS atreswheca ievadvasepoanmlandahavad ii, 825 polling the jury....... CREATE CM RS oes Gis aida anckistsy Seco, aver ii, 826 right of juror to dissent from verdict .............0ee eee ii, 326 how far may be reformed by............ ii Reablences a ecwiee Ly 826 entry of by clerk after................ ae/eisuaeiaigasie s sfespielsue's ii, 337 judgment on general, how entered............ iacerorsa sian 11,608, 609 form of in ejectment .......... cee eee ees eee jaan setlen ly 17 what to state in ejectment.............64 eevee puedes iii, 17 in action for admeasurement of dower.. ...........200005 iii, 94 in action to determine conflicting claims to real property .. iii, 147 AD TO PLO VIN 15 aac ae iaGe AOA henna Somes 3 4H Saieie exter, ce Udy 177 VERIFICATION: Of Pleading is ave eves seeds yer be earek sas odeiedebatear seg i, 260 when required ......... 2. > cee ee cece eect seen eee ceeeees i, 260 what is subsequent pleading, so as to require....... ee i, 261 dilatory defense must have.........-. cece ee eee eee eens i, 260 not sufficient affidavit to overthrow notary’s certificate .... i, 260 when necessary to require party to prove existence of COPPOTANOM ceccd cacasny sRedaKdcaden RINGS Heese ee ne 261 in answer, may refer exclusively to counterclaim .......- i, 261 ‘When MAY be OMIE Loss savas needed sane eae EERE SS 1,261, 262 defendant charged with fraud, when not excused from VELIEVIN SPOR G sss ic gsi viceanse Seoreiboasas akcrecs Gramnimrteale Gugins ts « i, 261 question of right to serve pleading without, how deter- Mined eedaennvcd gyyevsedeteseeee ae see os ecneniarven, 15 263 by whom'te: be: made os.55 5 so09 oe 44 Kone ees Estee a 263 how made by domestic corporation ..........+.++ ; . i 264 in action where people are party............eeeeeeee i 264 in action wnere public officer is party ............005 i, 264 j INDEX. 643 VERIFICATION—(Continued): VOL. PAGE when may be made by agent or attorney ............eeeee i, 264 when so made, omission to state reasons, fatal.... ... i, 267 in action on instrument for payment of money only....... i, 264. HOTMIOL sin tee te nek eee esa eRed Hele mee sth eae seas, go Uy 266 remedy Lor-derective:, sient waacawaeeaewaie uns Slee cals i 268 of answer in action for divorce ......0 ce... eee ewww ee eens iii, 221 VESSEL: attachment against, see ATTACHMENT. bill of sale, or mortgage on how proved...........6+ since Dl; 105 VIEW: of premises ........ Sie Wie eS NERA CREST ESS Sgihie 8 AT SA ii, 270 VILLAGE: ordinance, resolution, by-law, proceedings of board of trus- tees, how proved ..............55+ & faGporcs ayavnstaconaiorst tiaia «Hy 100 VOID: when proceedings are, for irregularity . .......e.eeeeeeee 651 W. WAIVER: of invalidity of process issued on Sunday, whenmade .. i, 4 of lack of jurisdiction of superior city court.............. i, 47 what waived by general appearance ..........e eee ee ees i,177, 178 of defects in motion papers.......... 0. ese ee eee eee Siaiadenaad i, 192 of stay, for non-payment of motion Costs...........0.000. i, 217 right to amend, how waived ........ceeceeeeee ceeeereee i, 283 of ‘privile@e fromvarrests icics ecsigs a vieg aes sister Bi se RH eeiais i, 412 of irresularity yc .rescssee pea sawewsane ce ee teseeeaaeere i, 655 none, without knowledge of facts........ Saye eee eaees i, 655 when intention of, will be inferred ............0..0008 soe) ay 656 Of Tight tortrial bY JULY sneseuse sewter tense cease nee'e'es . li, 192 of right to particular mode of trial................. eee eee ii, 192 GE -ChallenBe tO JOPOT -sisecvanaPisihres ear vew des ESR TOE WEES a2 SIE, 260 OL TIPHEO SOGUTY scrcausmedianes sateen wen eee ese cobs ge wes ii, 292 of irregularities in report of referee... 1.6... eee e eee eee ii, 381 of right to appeal ..... ...sseccsceees EhoiGieandeaneas ii, 648 of right to bring replevin ...... bia biateleatebere eiaie Sete wets eyes dll; 172 WARRANTY: allegations in action for...... dead SeeNveweeidans gomesexs, i 326 WASTE: parties to action for ... 0... cece eee eee eee aseteioneiets i, 135 when restrained by injunction................. essere lh 475 in what county action to be brought ........... cecueuanpiee, at, 110 action for to be tried by jury........ esse. e cece cee ewes ii, 187 remedy for, of purchaser of real property on execution.... ii, 856,857 may be restrained in action to admeasure dower.......... iii, 94 may be stayed by injunction in foreclosure ............... iii, 115 CONNEC’ seack eats Uauiyiatke ane a aek wt sepa O78 Oe OS fs iii, 150 remedies for, at common Jaw........ cece cee eee cee eaee iii, 151 WASTE—(Continued): 644 INDEX. VOL. PAGE action for, under Code of Civil Procedure.......... ..... Hl, 152 in what courts to be brought .... .... aa leig eeteta or dll; 152 WHERE TIADI EK daca cc edes weeks oe ones de bbe eee eee es iii, 152 by JOLY s wee die wee ee Sbises eteeeoe eeee4 iii, 152 PLOCCEMINES IN oc comiocewisdwreadedorwaae. abeseT ees iii, 152 who may be plaintiffs in... 6... cece eee eee eee renee iii, 152 who may be defendants in .............. cesses eeeee iii, 153 treble damages, when may be recovered in ........... iii, 154 IMust/ be ‘proved 1) ...552 geese we cmecetes senders iii, 155 what are damages ...........-600. anne sodas enna hap ovckalOa ili, 155 judgment in, what to contain ........... see eres eee iii, 155 by joint tenant or tenant in common..... divieeaawsecre Il, 156 WATER RIGHTS: when interference with, restrained....... Sie kc aie deeemmeloa i; 477 WILL: action to estabiish, when barred .... .....seeeceeeeeereee UL 72 additional allowance in action for construction of .. ...... ii, 514 action to establish or impeach. ........ ..s.eeeeee eee eee iii, 312 when may be brought........... 2... cece cece cece ees iii, +312 when validity, construction, or effect of determined in, iii, 313,314 when court bas jurisdiction of...........+.2 seeeee + iii, 314 who ma, bring such action ....... Meo easese sess She All, 315 who may be plaintiffs in .......... i ae RODS MSR AREAS iii, 315 who proper parties defendant in ..............0+200+- il, 316 pleadings in........... Basan e aes PR ne Siaieedecs ili, 310 proceedings in .............+4.. das eeoalace ie ddinuaee Setopuspodl, 316 receiver may be appointed in...... Seu sin He ereeers stra gsi iii, 317 how action to be tried .. 1.2... ee eee e ee ec ce ee ees iii, 317 what must appear to entitle plaintiff to judgment..... iii, 317 how existence of will to be proved in............... . iii, 317 what is fraudulent destruction of ......... sfavgacwisia cokers iii, 318 two witnesses required... 2.1... cee cee eee ee eevee seeargy Ally 318 judgment in such action ....... 0.0... cece eee eee eee iii, 318 when final judgment must direct will to be recorded .. iii, 318 copy of will must be included in final judgment .... __ iii, 319 WITNESS : non-resident, privileged from service of summons..... see, ay 154 resident, not so privileged............ ei vislee sive teeead se’ i, 155 when privileged from arrest.......-...+eeee eens desases t 410 when examined before trial...........eeesee eens Smeets ii, 7 for what purpose examination may be had........ ...... ii, 7 See EXAMINATION OF PaRTY. See COMMISSION. must be subpoenacd........... ee ceees teen eee swear “Ly 69 what court may issue subpoena,...........0006. Sevaueersaverit ody 69 fees upon must be paid... 2... cece eee cece eee eee ii, 71 fees of, how may be waived. ............4 ie Aare arava ecensuats “Aly 71 when party entitled to witness fees .... weceeeeeeeeeeaee ii, 72 entitled to fees for each day..........+. aovavoiads ae Bee ii, 72 INDEX. 645 WITNESS—(Continued): VOL. PAGE duty of, upon subpoana........ cceccevecpescecccccceces Hy "2 excuse for non-attendance...... cei ais wie eieieiaicialelaieists ee's acs's'ei SUD 73 must remain present in court.........+6 WeGwieedacs sense ii, 73 need not be sworn unless fees paid...........200 eum bees ii, 13 how compelled to produce document.......sseeceeeeeees ii, 74 when relieved from order to produce.......+.++ nostetece ih, 1 fees upon subpaena, duces tecwm or order.......- sea wt ii, vis) duties of upon... .. Sede Maun ai nnarsige aie eS Scerays seared Dy % See Susp@na Ducres TECUM. habeas corpus, to bring up to testify...........65 eesereear dl; 80 See HABEAS CORPUS. absence of when ground to postpone trial..... wieeseanineder Uy 16 examination Of............seeeeceeeceee ‘dete vatsreotela’e'e cisteiese; All 270 only one counsel to examine............06% dois sterile’ ase UML, 272 when leading questions to be allowed...... Weis vede~ecng. Hy, ~ 272) recollection of, how refreshed............. we eke oad oie ab 272 See TRIAL BY JURY: re-direct examination of............. Sts eases seen are dy 200) impeachment of, how done......... eco iereie sves ers adajseisiae ak Ap 279 by proof of bad character........... 26+ Sb bieie ee Berets ii, 280 specific acts cannot be proven ON.......ececceescceee ii, 280 how far party can impeach his OwWn..........e.e00 soe ee ii, 279 must produce paper if subpcenaed to do 80..........05-6- ii, 282 how far memory may be refreshed by memorandum...... ii, 282 opposite party may inspect memorandum used..........+- ii, 285 judge presiding cannot be called as............eeeeeeeees ii, 285 Juror May DES WOTD AS... 6.6 ee cee cece eee teen ee eees «o Hi, 285 may be subpcenaed to appear before referee...... eww execs ii, 360 upon reference, when testimony of to be signed........... ii, 375 fees of, when allowed as disbursements.......,....ee000. ii, 528, 524 fees of upon subpoena ........... cece ere e scenes saad ii, 560 fees of, when deposition taken.......... cc ccc ec eee ccc eee ii, 561 party not entitled to fees as........ cn n'eiaigtereiey Ws anaeeiet ii, 561 how compelled to testify in supplementary proceedings.... iii, 457 See, also, SUPPLEMENTARY PROCEEDINGS. WORK AND SERVICES: allegations in action for............. ctcescarevecccccscce 1, 326 WRIT: amendment Of.........+0- RSS BSAs Rae soneweree ere sasecee” Oly 636 WRIT OF EBROR: abolished..........+..e0. SBR bie) as Rew wisi oie ini 6ieisie tote -alelv'e ayy Aly 648 WRIT OF INQUIRY: GeMNE eadeew es Like ied. Bs ee Selon etrlataeieees sbieaweeeeas ii, 600 how attested on return.......... cece eee eee alte sisiaie ie aéoee AE 600 against whom executed........cceseeceeeecececeseeeees ii, 600 may be executed at circuit ....... 2... ceeeee cence eeeeee ii, 601 duty of judge in such caseS....... seeeseeeeee ee eee ii, 601 jury on, where Grawn......seeeeeeee cere cence ence eens ii, 601 646 INDEX, WRIT OF INQUIRY—(Continued): VOL. PAGE duty of sheriff where writ directed to him. .....seee..eee ii, 601 when notice of hearing required..........ceeseeeceeees eee a; 601 must be executed within the county...........e+e0 See ees ii, 601 hearing may be adjourned by sheriff.........eeeseeeeeee- ii, 602 when defendant entitled to costs on adjournment.......... ii, 602 jury on execution of writ ............006- i ala, ea aveeialerars ii, 602 proceedings upon execution Of WYit.....-.-..cereeveeceee ii, 602 IUQUISIMION: su ertesdacc weet s MRE S CEA Soeeee Sele bares eees ii, 603 how proceedings on writ reviewed....... 5.6 Wie Swiss Swreraetbiae ii,605, 606 motion to set aside inquisition on...... Siejaarstesaieieets aavaiers: oily, 606 for what irregularities vacated...... sane caetinn sees were Hy 607 ¥, YONKERS. CY COUT OF oS sissieicsismiaGisiecwsisiae yen sees ecudi’seace sacee Li, 694 appeal to court of appeals from action commenced in...... ii, 694 appeals from judgment of..... ais iareseigiaiernere evans eibsateocae.e are, 164